KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_07815Help
Entry
B4966_07815       CDS       T05394                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase HDOD Pkinase_Tyr APH GAF Kdo Pkinase_fungal Kinase-like RIO1 LRV
Motif
Other DBs
NCBI-ProteinID: AUM00077
UniProt: A0A2K9LAR9
LinkDB All DBs
Position
1667335..1669710
Genome map
AA seq 791 aa AA seqDB search
MGEHIGRFEIRGELGRGAQSAVYLAFDPHLERDVAVKTLHFSAASARQNIDLLGEARLVS
KLRHPGIVPIFEVGEQDGDLYLVFEYVPGESLAQLIGREAPLPAARAASLMSAILAAIAH
AHREGIIHRDLKPSNILIDERGNPRVMDFGIARRIEGGGSSSRELSGTPAYMAPEYIAGH
MVSEQTDVFAAGLILLEMLTGRCVFEGDSPQAIIDKVAKQAVAIPAGVTVEPRIAAIALR
AVAHDPQERFRSAEEFCQALDAFLAPPEEDRDRQAAQSTVEFLLRRMRHKSDFPALSESV
SAINRIASSETESIDALSLTILRDFSLTNKILRLVNSAHYRQAGGGNISTISRAIIVLGF
DAVRNIAITVLLFEHLQDKANANVLKEEFLRANLAGILAKDIAVQIKTRDLEQAFICSMF
HNLGRLLAQFYFPEETEEIRNLVASKACSEAAAAQRVLGIGFEELGIGIARSWGFPPLIV
NSMERLPPGAVRRPRTPEERLRALSSYANDLCQALTIQDSAAREKELGRIGARYGDAVTL
DKKSVREVLLRAIEQVADFARIVRINLGQTPFGQQLRRFAGTDRAAAPTAEDITLGGAAL
AWETPAGLDTGNFPAEGQKAADAQALLTAGIQDISNTLVSDFKLNDILRIILETMYRAMG
FHRVLLCIKDAHTNTMRGRFGFGPQVDELARAFRFTLRFTPDIFHAATSKGVDILITDID
DDKIADRIPDWYRKASTAKTFVLFPLTVKSNPVALIYADKPHAGDIEITEKELQLLRTLR
NQALLAIKQST
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaacatatcggccggtttgaaatcaggggggagctggggcgcggcgcgcagagc
gcagtctatttggccttcgatccgcatctcgaacgtgacgtcgcggtcaagaccctgcac
ttttcagccgccagcgcccgacagaacatcgacctgctgggcgaagcgcgcttggtcagc
aaactgcgccaccccggcatcgtgcccatttttgaagtgggcgaacaagacggcgatctt
tatctggtattcgaatatgtgccgggcgaaagcctcgcgcaactgatcggccgcgaagcg
ccccttcctgctgcgcgcgcggccagcctgatgtctgccattcttgccgccatcgcccat
gcgcatcgagaaggcatcattcaccgcgacctgaagccatcgaacatactgatcgacgaa
cgcggcaaccccagggtaatggatttcggcatcgcccggcggatcgaaggcggtggatcg
tcctcgcgtgaattatccggcaccccggcctacatggcgcccgaatacatcgccgggcat
atggtcagcgagcagaccgacgtgtttgccgccggcctgattttgctggaaatgctcacc
ggccgctgcgtgtttgaaggtgacagcccccaggccatcatcgacaaggtagccaaacag
gcggttgcaatcccggccggcgtgacggtcgagccgcgcatcgctgccatcgccctgcgc
gcggtggcgcatgatccgcaggagcgttttcgcagcgcggaggaattttgccaggcgctg
gacgctttccttgctccgcccgaggaggaccgcgaccgtcaagccgcacaaagcacggtg
gagtttctgctgcgtcggatgcgccacaagagcgactttccggcgctgtccgaatcggtg
agcgcaatcaaccggattgcttcgagcgaaaccgagtcgatcgacgcgctgtcgctgacc
atcctgcgcgatttctcgctcaccaacaaaatcctgcgcctggtcaattccgcccattat
cgccaggccggcggcggtaacatcagcaccatctcacgcgcgatcatcgtgctgggcttc
gatgcggtgcgcaacatcgccatcaccgtgctgttgttcgagcatctgcaggacaaagcc
aacgccaatgtgctcaaggaagagttcctgcgcgccaatttggccggcatcctcgccaag
gacatcgccgtccaaatcaagactcgcgacctggaacaagcctttatctgctcgatgttt
cataacctcggcagactgcttgcgcagttctactttcccgaagaaaccgaggaaatccgt
aatctggtagcgagcaaggcgtgtagtgaagcggccgcggcgcagcgggtgctgggaatc
ggttttgaagagctgggcattggcatcgcccgcagttggggctttccgccgctgatcgtc
aatagcatggaaagactgccaccgggcgcggtgcgccggccgcgcacgccggaagagcgg
ctgcgcgcgctgtcttcttacgccaacgatctgtgccaggcccttaccattcaggatagc
gccgcacgggaaaaagaactcggccgtatcggcgcgcgctacggcgatgcggtcacgctg
gacaaaaaaagcgtgcgcgaagtgctgctgcgcgccatcgaacaggttgccgattttgcc
cgcatcgtccgcatcaatctcggtcagaccccgttcggccagcaactgcggcgctttgcc
gggaccgaccgcgcagcggcgccaacggccgaggacatcacgctggggggcgcagcactg
gcgtgggagacacctgccggactggataccggcaatttccccgccgagggacaaaaggct
gccgacgcccaggcgctgctgaccgccggcattcaggacatcagcaacactttggtgtcc
gacttcaagctcaacgacatcctgcgcatcattctggaaacgatgtaccgggccatgggc
tttcaccgagtgttgctgtgcatcaaggatgcgcacaccaacactatgcggggtcggttc
ggtttcggcccgcaagtcgatgaactggcacgcgccttccgtttcacgctgcgctttacc
ccggatattttccacgcggccacttccaaaggcgtagacatcctgatcaccgacatcgac
gacgacaagatcgccgaccgcattccagactggtaccgcaaagcctcgactgccaagacc
ttcgtgctctttcccctcacggtcaaatccaaccccgtagccttgatctacgccgacaag
cctcacgccggcgatatcgaaatcaccgaaaaagaactgcaactgttgcgcactttgcgc
aatcaggctctgctcgccatcaaacaatccacttag

DBGET integrated database retrieval system