KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_10985Help
Entry
B4966_10985       CDS       T05394                                 

Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
Pathway
rbh00620  Pyruvate metabolism
rbh01100  Metabolic pathways
rbh01120  Microbial metabolism in diverse environments
rbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B4966_10985
Enzymes [BR:rbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     B4966_10985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: AUM00632
UniProt: A0A2K9LCE5
LinkDB All DBs
Position
complement(2282106..2284406)
Genome map
AA seq 766 aa AA seqDB search
MDQDFIAAALDYHRSPTRGKISVVPTKGLTNQHDLALAYSPGVAAACDAIVADPGQAREL
TSRGNLVAVVTNGTAVLGLGNIGPLAAKPVMEGKGCLFKKFANIDVFDIELAENDPDKLI
DIIAALEPTLGGVNLEDIKAPECFYIEQKLRERMKIPVFHDDQHGTAIISSAGLINGLKL
VGKDIGQVKLVCSGAGAAAIACLDLMVSLGLKRENVFVCDSKGVIYQGREANMEANKARY
AQITEARTLADAIEGADVFLGLSTAGVLKPEMVQKMADKPLIFALANPTPEILPEEAKRV
RPDCIIATGRSDYPNQVNNVLCFPFIFRGALDVGASTINEEMKLACVKAIAELAQAEQND
IVASAYGGADLSFGPDYIIPKPFDPRLIVKIAPAVAKAAMDSGVATQPLEDLAAYAASLT
DFVYQSGVIMKPVFSAAKRVPMEQKRVVYAEGEDPRVLHAVRVVIDEELARPILIGRPGV
IEMRIKKIGLNLVPGRDFEVVNPESDPRYRDLWNEYFRLMSRDGVTPDIAKAKMRRDTTL
IGCMLLRTGDADALVCGTFGTYDYHLKQVQDVIGLKPGCKQFAAMNILLLPKRMLAVTDT
YVNENPSAEEIAEIARMAADELRRFGVEPRVALLSHSNFGSSTSASARKMRAASDILRAS
NPELICDGEMHGDAALNAQIRAKVNPDSTLQGEANLLVMPNLDAANISFNLMKIANGDGV
SVGPMLLGAALPVHILTPSATVRRLVNITAVSVVDAAEQRLQHAQG
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggatttcatcgccgcggcgctggactatcaccgttcgccgacgcggggcaag
atttcggtcgttccgaccaagggtctaaccaatcagcacgatctggcgctggcttattcg
cccggcgtcgccgcagcctgcgacgccatcgttgccgatccgggccaggcgcgcgagctc
accagccgtggcaacctggtggcggtggtcaccaacggcaccgcggtgctggggctgggc
aacatcgggccgctggccgccaaaccggtgatggagggtaagggctgcctgttcaagaag
tttgccaacatcgacgtgttcgacatcgagctggcggaaaacgaccccgataagctgatc
gacatcatcgccgcgctggagcctaccttgggcggggtgaatctggaagatatcaaagcg
cccgagtgcttctacatcgagcagaagctgcgcgagcgcatgaagattccggtgttccac
gacgaccagcatggcacggcgatcatttcctcggccgggctgatcaacggcttgaagttg
gttggcaaggacatcggccaagtgaagctggtgtgttccggtgccggtgcagcggccatt
gcctgcctggacctgatggtgagtctgggcttgaagcgcgaaaacgtttttgtgtgcgac
tccaaaggcgtcatctatcaagggcgcgaggcgaacatggaggccaacaaggcgcgctat
gcacagatcaccgaagcgcgcaccctggccgatgcgatcgaaggcgcggatgtattcctg
gggctgtcgaccgcgggcgtgctcaagcccgagatggtgcagaaaatggccgacaagccg
ttgatctttgcgctggccaatcccactccggaaattctgccggaagaggccaagcgggtg
cgcccggactgcatcatcgccaccggccgttcggactatccgaaccaggtgaacaacgtg
ctgtgcttccccttcatcttccgcggcgcgctcgacgtgggcgccagcaccatcaacgag
gagatgaagctggcatgcgtcaaagccattgccgaactggcccaggccgaacaaaacgac
atcgtcgcctcggcgtacggcggtgcggatttgtcgtttggtcccgactacatcattccc
aagcctttcgatccgcgtctgatcgtcaagatcgccccggcggtggccaaagcggcaatg
gattccggcgtggccacccagccgctggaggaccttgccgcctatgccgccagcctgacc
gatttcgtctatcagtccggcgtgatcatgaagccggtgttttcggccgccaagcgtgtg
ccgatggagcaaaagcgtgtggtgtacgccgaaggcgaggatccgcgcgtactgcatgcg
gtgcgcgtggtgatcgatgaggagttggcgcgccccattttgatcggccgaccgggcgtg
atcgagatgcgcatcaagaagatcggtctgaacctggtgccgggacgggatttcgaagtg
gtcaatccggaatccgacccgcgctatcgcgacctgtggaacgaatacttccgcctgatg
agccgcgacggcgtgaccccagacattgccaaggccaagatgcgccgcgacaccacgctg
atcggttgcatgctgctacgtaccggcgatgcggatgcgctggtatgcggcacttttggc
acctacgactaccacctcaagcaggtacaggacgtgatcggtctcaagccgggctgcaag
cagtttgcggccatgaacatcctgctgttgcccaagcgtatgctggcggtgaccgacacc
tatgtgaatgagaacccgagtgccgaggaaatcgccgaaattgcccgcatggcggccgac
gagttgcggcggtttggcgtggagccgcgggtggcgctgctgtcgcactccaattttggc
agctctacatcggcttccgcccgcaagatgcgggcggccagcgacattttgcgcgcttcc
aatccggagctgatctgcgacggtgaaatgcacggcgatgccgcgctgaacgcgcagatc
cgcgccaaggtcaatccggattccaccttgcagggcgaggccaatctgctggtgatgccc
aatctggatgccgccaatatctccttcaatttgatgaagatcgccaacggcgacggggtg
tcggtgggcccgatgctgcttggcgccgcactgccggtacatattttgacgccttcggcc
acggtgcgccggctggtcaacatcaccgccgtgtcggtggtcgatgccgccgagcagcgt
ctgcaacacgctcagggctga

DBGET integrated database retrieval system