KEGG   Rhodocyclaceae bacterium Thauera-like: B4966_12435Help
Entry
B4966_12435       CDS       T05394                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rbh  Rhodocyclaceae bacterium Thauera-like
Pathway
rbh00620  Pyruvate metabolism
rbh00680  Methane metabolism
rbh01100  Metabolic pathways
rbh01120  Microbial metabolism in diverse environments
rbh01200  Carbon metabolism
Module
rbh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B4966_12435
  09102 Energy metabolism
   00680 Methane metabolism
    B4966_12435
Enzymes [BR:rbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B4966_12435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AUM00874
UniProt: A0A2K9LCP3
LinkDB All DBs
Position
2580503..2583256
Genome map
AA seq 917 aa AA seqDB search
MAENTPPTDKDAPLREDIRLLGRLLGDTVRDQLGEASFALIERIRQTSVRFRRYEDLEAR
RELEGILDALAREQTIQVVRAFSYFSHLANIAEDQHHIRRSRAHLLAGSAPREGSLAHAL
DKTSRLLGEAATEALTRFFSQALVCPVLTAHPTEVQRKSILNCQTVIARLLDERDRMRLT
PEEAAANDAALRRAVLTLWQTRMLRPVRLSVIDEVNNGLSYFETTFLRELPRLYASVEDR
LAASSGELPAFLQVGSWIGGDRDGNPFVTAEVLERALALQAAAVLGFYLEELHALGSQLS
LAAGLVEVSDALQALADRSVDHSPHRRDEPYRRAIAGMHARLAATWNAWLGSSPPSPPVA
PAAPYLRPAELAEDLNTIDRSLVANGSAALAGGRLRHLRCAVKVFGFHLAPIDLRQNADV
HERVIAELLATAGGVADYRALDEAARVALLLRELASPRPLASPHLRYSDETESELAIFRA
ARAAHLRFGPAVIQNCIISKTDAVSDVLELAVLLKEAGLLRPHENALDVNIVPLFETIED
LRNAPGVMDRLFTLEPYRALLASRGFLQEVMLGYSDSNKDGGFLTSGWELYKAEIGLAEV
FARHRVRMRLFHGRGGSVGRGGGPSYQAILAQPGGAVQGQIRLTEQGEVIAAKYGNPEVG
RRNLEVLVAATLEASLLSGEALAPDPAFLDTMQTLSDSAFSAYRGLVYQTPGFEDYFWQS
TVISEIAELNIGSRPASRKKGRRIEDLRAIPWVFSWSQCRLMLPGWYGFGSAVKAWLATH
PQEGLAHLQRMYREWSFFATLLSNMDMVLAKTDLAIAARYAELVHDSTLRETIFQRICRE
WQDTVDALLAITGQQELLDGNPLLKRSIRNRFPYLDPLNHVQVELLRRHREQPGDDRLRA
GLHISINGIAAGLRNSG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaacaccccacccaccgacaaggatgcgccgctgcgcgaagatatccgcctt
ttgggccgccttttgggcgacaccgtgcgcgaccaattgggcgaagccagctttgcgctg
atcgagcgcatccgccagacctcggtgcgctttcgccgttacgaggatctggaggcccgt
cgcgagttggaaggcatcctggacgccctggcgcgcgaacagaccatccaggtggtgcgg
gccttcagctacttttcgcatctggccaacatcgccgaagaccagcatcacatccgccgc
tcacgcgcccacttgctcgccggctccgccccgcgcgaaggcagcctggcccacgcgctg
gataaaacctcgcggctgctgggcgaagcggccaccgaagcactcacccgctttttcagc
caagccctggtctgcccggtgctgaccgcccacccgaccgaagtacagcgaaagagcatc
ctcaactgtcaaacggtgatcgcccgcttgctcgacgaacgcgaccgcatgcgcttgacc
cccgaggaagcggccgccaacgacgccgcactgcgccgcgcggtgctcaccctgtggcag
acccgcatgctgcgcccggtgcggctgtcggtgatcgacgaagtcaacaacggtctgtcc
tacttcgagaccacttttttgcgcgagctaccgcgtctatacgccagcgtagaagaccgc
ctggctgcctccagcggcgaactgccggctttcttgcaagtcggcagttggatcggtggc
gaccgcgatggcaaccccttcgtcaccgctgaggtgctcgaacgtgcgctcgccctgcag
gctgccgccgtactcggcttttacctggaggagcttcatgcgctgggctcccagctctcg
ctcgcggcgggcttggtcgaagtctccgatgcgctgcaggcgctggccgaccgttcggtg
gaccactccccgcatcgccgcgatgaaccgtatcggcgcgcaatcgccggcatgcatgcc
cgcctggcagccacctggaacgcttggctgggcagctcaccgcctagcccaccggtggcc
ccggccgcgccctaccttcgccccgccgagctggccgaggatctcaacaccatcgaccgc
tcgctggtagccaacggctcggccgcgctcgccggcgggcggctgcgccacttacgctgc
gcggtcaaagtgtttggctttcatctggcgcccatcgacctgcggcaaaacgccgacgtg
catgaacgtgtgatcgctgaactgcttgccaccgcaggcggcgtagccgattaccgggcg
ttggacgaagccgcgcgggttgcgcttttgctccgcgaactcgccagcccccgccctttg
gcctcgccgcacctgcgctatagcgacgaaaccgagtccgaactggccatcttccgcgcc
gcgcgcgccgcccacctgcgctttggccccgccgtcatccagaactgcatcatctccaaa
accgatgcggtctccgatgtccttgaactggccgtgctgctcaaagaggcgggtttgtta
cgaccgcatgagaacgcgctggatgtcaatatcgtgccgctgttcgagaccatcgaagac
ctgcgcaacgcgccgggcgtgatggatcgcctgttcaccctcgaaccctaccgcgcgctg
ctggcctcacgcggtttcctgcaagaagtcatgctgggctattcggacagcaacaaggac
ggcggctttttgacctcgggctgggagctttacaaagccgaaatcggcttggccgaagtc
tttgcccgccaccgggtgcgcatgcgcctgtttcacggccgcggcggatcggtggggcgc
ggcggggggccgagctaccaggccatcctcgcacaaccaggcggggcggtgcagggccag
atccggctgaccgaacagggcgaagtcatcgccgccaagtacggcaacccggaagtgggt
cgccgcaaccttgaggtgctggtagccgccaccctggaggccagcctgctctccggcgaa
gcgctcgcgccggatccggcctttctggacaccatgcagacgctctccgacagcgctttt
tccgcctaccgcggcctggtgtaccagacccccggtttcgaggactacttttggcaatcc
acggtgatcagcgagattgccgaactcaacatcggctcacgcccggcctcgcgcaagaag
ggcagacgcatcgaagacctgcgtgccattccctgggtgttttcgtggtcccaatgccgg
ctgatgctgcccggctggtacggctttggcagcgcggtcaaagcctggctggccacccac
ccgcaagaggggcttgcccacctgcaacgcatgtaccgggagtggtctttctttgctacc
ttgttgtcgaacatggatatggtgctcgccaagaccgacctcgccattgccgcccgctac
gccgaactggtgcatgacagcacactgcgcgagacgatcttccaacggatctgccgtgaa
tggcaggacacggtcgatgccttactggccattaccggccagcaggaactgctcgatggc
aacccgctattgaagcgctcgatccgcaaccgcttcccctatctcgacccactgaaccat
gtccaggtcgaactgctgcgccgccaccgcgaacaacccggcgacgaccgcctgcgcgca
gggctacacatctcgatcaacggcattgccgccggcttgcgcaacagcggctga

DBGET integrated database retrieval system