KEGG   Robiginitalea biformata: RB2501_02240Help
Entry
RB2501_02240      CDS       T00992                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00620  Pyruvate metabolism
rbi00680  Methane metabolism
rbi01100  Metabolic pathways
rbi01120  Microbial metabolism in diverse environments
rbi01200  Carbon metabolism
Module
rbi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RB2501_02240
  09102 Energy metabolism
   00680 Methane metabolism
    RB2501_02240
Enzymes [BR:rbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RB2501_02240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: EAR14206
UniProt: A4CP85
LinkDB All DBs
Position
complement(3305291..3307837)
Genome map
AA seq 848 aa AA seqDB search
MSQVERLKEFKKSVRNKFNIYNSLFLNLPYTEGENVGIYIPLLFQQCDRGLKSGKNPTEI
LDDFFENFTQATDEKERIDLMFRIIQYVERQVVLYDSVEDAAFPRLHVHTDSLSIRDYFQ
LAKKNKRWDKVSKKLESFSARIVLTAHPTQFYTPAVLDIIAELRTLILENKIDEIDVTLQ
QLGLTSLINSKKPTPLDEAKNIIYTLRHVYYQAVGDLYAYIKGSIENDAYDNPDIIKLGF
WPGGDRDGNPYVTADITMDVADELRTTLMKCYYNDLKTLQKRISFRGVQEQMQQLRGKAY
VAMFDTSKTLSYEEMIETLREIREILVRDYYGLYLKELDHFIDKVRLFKTHFATLDIRQD
HSKHYQVVETVLRHHGLIKESLDELPEERLVELLTRESLELDPSAYDDPIVKDTLVNMAQ
LEEIQRKNGEDGCNRYIISNSEDIFSVLFVFGLLRWSGWKNRDLTFDIIPLFETMKGMAE
AESVMQTLFDLPEYRAHVAQRRDLQTIMLGFSDGTKDGGYLKANWSIFKTKETLSRVCRR
NKIKAIFFDGRGGPPARGGGKTHRFYAAQTKAIANHEIQLTVQGQTITSTFGTKELFMHN
SEQLLTAGLSNTIFGKENVIDKSQRDLLETLSELSFEKYNALKQHELFLPYLENRSTLKY
YSNANIGSRPGKRGNKAKLEFSDLRAISFVGSWSQLKQNVPGYYGIGTALKQLKDEGRMP
ELKKMYKEVAFFRALMLNSMMSLTKCYFELTSYMKEDEVYKGFWEMLYREYKLSKQMLLQ
LSGYKVLMENESVSRESVKIRENIVLPLLVIQQYALHRIAEGTDRKELYEKIVTRSLYGN
INASRNSA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggtcgaacgactgaaagaattcaaaaaatccgtacgcaataaatttaacatc
tataacagcctcttcctgaacctgccctatacggaaggggaaaatgtgggcatctatatc
ccacttttgtttcagcaatgtgatcgcgggctcaaatcggggaagaacccgacggaaatc
ctcgacgatttctttgagaattttacccaggcgacagacgagaaggagcgcatcgacctg
atgtttcggataatccagtacgtggaacgccaggtggtgctctacgacagcgtggaggat
gccgctttccccaggctccacgtgcacacggattccctgtccatccgcgactatttccag
ctggccaaaaagaacaagcgctgggacaaggtttctaaaaagctggaatccttcagcgcc
cgtatcgtcctgacggcccacccgacgcagttttacacgccggccgtactggacatcatc
gccgagctccgcacgctgattctggagaacaagatcgacgagatcgacgtgaccctccag
cagctgggccttacctccctgatcaacagtaaaaagccgactcccctggacgaggccaaa
aacatcatctatacgcttcgccatgtttactaccaggcagtcggagacctctatgcgtat
atcaaggggagtatcgaaaacgacgcgtacgacaacccggacatcatcaagctgggcttc
tggccgggcggcgaccgggacgggaacccctatgtcaccgcggatatcaccatggacgtg
gccgacgaactccgcaccaccctgatgaaatgttattacaacgacctgaaaaccctgcag
aagcgcatctcgttccgcggggtacaggaacaaatgcagcaattgcggggcaaggcctat
gtggccatgttcgatacgagtaaaaccctgtcttatgaggagatgatcgaaaccctgagg
gaaattcgggaaatcctcgtacgggactactacgggctttacctgaaggaactcgaccat
tttatcgacaaggtgcgattgtttaaaacgcacttcgccacgttggatattcgccaggat
cacagcaagcactaccaggtggtggagacggtgctccggcaccatggcctcattaaagaa
tccctggacgaattaccggaggagcgcctggtggagttgctgacccgggaatccctggaa
ctcgacccgtcggcctatgacgaccccatcgtgaaggatacgctggtcaatatggcacag
ctcgaggagatccagcgcaaaaacggggaagacggctgtaaccggtatatcatcagcaac
tcggaggatatcttctccgtcctctttgtgttcgggctgttgcgctggtccggttggaaa
aaccgggacctgaccttcgatatcatcccgctctttgagaccatgaaggggatggccgag
gcggaatccgtgatgcaaaccctgttcgacctgccggaataccgggcccatgtggcccag
cggcgggacctgcagaccattatgctcgggttttcagacgggaccaaggacggggggtac
ctgaaggccaactggtcgatattcaaaaccaaggaaaccctttcccgtgtttgccggcgc
aacaagatcaaggcgatattcttcgacggccgcggcggcccgcccgcccggggcggcggc
aaaacccaccggttttatgcagcccagaccaaggccatcgccaaccacgaaatccagctg
accgtacaggggcagactattaccagtaccttcggcaccaaggaattgtttatgcataac
agcgaacagctgctgactgcaggcctttcaaacacaatcttcggcaaggagaacgtcatc
gacaaatcccagcgggacttgctcgaaaccctgtccgagctgagttttgaaaaatacaat
gccctcaagcagcacgagctcttcctgccttacctggaaaatcggagcacgctgaaatat
tattcaaacgccaatatcggcagccgccccgggaaacggggcaataaagcgaagctggaa
ttctccgacctgcgggccatttcgtttgtcggttcctggagccagctcaagcagaatgtc
cccggctactatggcattgggacggccctgaaacaactcaaggacgaggggcggatgccc
gaactcaagaagatgtataaggaggttgctttcttccgggccctgatgctcaacagcatg
atgagtctcaccaaatgttattttgaactcaccagctatatgaaggaggacgaggtttat
aaggggttctgggagatgctgtaccgggagtataagctctcaaaacagatgctcctgcag
ctctccggctacaaagtcctgatggaaaatgagtcggtttcccgggagtccgtgaaaatt
cgcgagaacattgtgctgccccttttggttatccaacaatacgccctgcatcgaattgcc
gagggcacggaccggaaggaactctacgaaaagatcgtgacccgctccctctacggcaat
atcaatgcgagccggaactcagcctga

DBGET integrated database retrieval system