Robiginitalea biformata: RB2501_02510 Help Entry RB2501_02510      CDS       T00992                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism rbi  Robiginitalea biformata Pathway rbi03060   Protein export rbi03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:rbi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     RB2501_02510  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     RB2501_02510  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:rbi02044]     RB2501_02510 Secretion system [BR:rbi02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    RB2501_02510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF1664 DUF948 Rx_N Motif Other DBs NCBI-ProteinID:  EAR14260 UniProt:  A4CPD9 LinkDB All DBs Position complement(3358820..3359092) Genome browser AA seq 90 aa AA seqDB search MQFLFISGAEIFFILFIVVMVFGADKIPGIAKGLGQGMRQLKDATDDIKREIHKSAEKQG IDTSFTKEIEKDLKDVKKNIDDVGGTIRRK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcaattcttatttattagcggggcagagatattttttattctctttatcgtggtgatg gtttttggagcggataagatcccggggattgccaaaggcctgggccagggcatgcgccag ctcaaggacgcaaccgacgatatcaagcgcgagatccacaaaagcgccgagaagcaggga atcgacacctcctttaccaaggagattgagaaagacctcaaggacgtcaagaagaacatc gacgacgtaggcgggaccatccgccgcaagtaa

DBGET integrated database retrieval system