KEGG   Robiginitalea biformata: RB2501_03905Help
Entry
RB2501_03905      CDS       T00992                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rbi  Robiginitalea biformata
Pathway
rbi00020  Citrate cycle (TCA cycle)
rbi00310  Lysine degradation
rbi00380  Tryptophan metabolism
rbi01100  Metabolic pathways
rbi01110  Biosynthesis of secondary metabolites
rbi01120  Microbial metabolism in diverse environments
rbi01130  Biosynthesis of antibiotics
rbi01200  Carbon metabolism
Module
rbi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rbi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RB2501_03905
  Amino acid metabolism
   00310 Lysine degradation
    RB2501_03905
   00380 Tryptophan metabolism
    RB2501_03905
Enzymes [BR:rbi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     RB2501_03905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: EAR16009
UniProt: A4CGF1
LinkDB All DBs
Position
complement(149286..152108)
Genome map
AA seq 940 aa AA seqDB search
MDRYSFLNAAHTAFFSDLYDRYLTHPDSVEPSWRAFFQGFDFGMESALEEIGIDAEAGVV
RTAGGDEAAMPLSLKKEFQVVRLIDGYRSRGHLFTQTNPVRERRTYTPSLEIENFGLEES
DLEKVFSAGDIIGIGPSTLREIIDHLTRIYCDAIGVEYMYIRSPERVEWIQQWLNVNDNH
PNFSPERKKYILRKLNEAVSFEGFLHTKYVGQKRFSLEGNESLIPAVDAIVERAAELGVQ
QFVMGMAHRGRLNVLTNIFGKPATDIFSEFEGKDYEQEIFDGDVKYHLGWTSMRKTNSGD
SINMNIAPNPSHLETVGAVVEGITRAKQDRHFPEDFSKVLPIVVHGDAAIAGQGIAYEVV
QMAGLDGYGTAGTIHIVVNNQIGFTTNYLDGRTSTYCTDVGKVTLSPVLHINADDAEAVV
HAALFALEYRMKFRRDVFLDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHQNPRDIYAERL
MSEGVIDADFVKKLEEDYKAKLEEELRDSKKEDKTRITAFMADEWDGFENVREWEMMEPV
ETGVPKDKLEAVARVITQLPEDKKFLRKVDKLVKERHKMFFETNRLDWAMGELLAYGTLL
QEGFDVRISGQDVERGTFSHRHAVMKVEESEEEVLLLNHISEEQGDFQIYNSLLSEYGVV
GFEYGYAMASPNTLTIWEAQFGDFSNGAQIMIDQYLSAAEDKWKLQNGLVLFLPHGYEGQ
GAEHSSARMERYLQLCARDNMYVADVSTPANLFHLLRRQMLVNFRKPLVVFTPKSLLRHA
KCVSTVEELAEGRFQEVIDDAGASVKKVKSLVFCTGKFYYDLLAAREELGREDVALVRLE
QLFPLPVVQMEELIEKYSHAEDLVWAQEEPRNMGAWSHLMMHFPDASRFRVASRRFYASP
AAGSPARSKMRHQQVIDYVFDPKKDNMSRPVPADVATDEE
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggatagatattccttcttaaacgcggctcataccgcttttttttcagacctatacgat
cggtacctcacccacccggacagtgttgagcccagttggcgcgcatttttccagggattt
gatttcgggatggaaagcgccctggaggaaatcggcatcgatgcggaggccggggtggtg
cgcacggccggaggggatgaagcggccatgccgctctcgctcaaaaaagaattccaggtg
gtgcggctcatcgacgggtaccgcagccgcgggcacctgtttacccaaacgaacccggta
agggagcggcgcacctatacgccttccctggaaatcgaaaatttcggattggaggaatcc
gacctggagaaggtgttcagcgcgggggatatcattgggatcggcccgagcacgctgcgg
gagatcatcgaccacctcacgcggatctactgcgacgccatcggcgtggaatacatgtat
atccgcagcccggagcgggtagagtggatccagcagtggctcaacgtcaatgacaaccac
ccgaatttcagcccggaacgaaaaaaatacatcctccgcaaactcaatgaggcggtttcc
tttgaaggcttcctccacacaaaatacgtcggccagaaacgtttttccctggaagggaat
gaatcgctgatcccggcggtggacgccatcgtggagcgggcagccgaactgggcgtccaa
cagtttgtcatgggaatggcccaccggggccgcctgaatgtactcacaaatattttcggg
aaacccgcaaccgatatcttcagcgaattcgaaggcaaggactacgaacaggaaattttt
gacggggacgtgaaataccacctggggtggacctccatgcggaagacgaattccggggat
agcatcaatatgaacattgcgcccaacccctcccacctggaaacggttggggcggtggtt
gaagggattacccgggccaaacaggaccggcacttccccgaggatttttccaaggtcctg
ccaatcgtggtccacggggacgccgccatcgccggccagggcattgcctacgaggtggta
cagatggccggcctggacgggtacggcacggccggtacgatccacattgtggtcaataac
cagatcggctttaccacgaattatctggacgggcgtacctccacgtactgcacggacgtg
gggaaggtgaccctgagcccggtactccacatcaatgcggacgatgcggaagccgttgtg
cacgctgccctctttgccctggaataccggatgaaattcaggcgggatgtattcctggac
ctgttgggttaccgcaaatacggccacaacgaaggggatgagccgcggtttacgcagccc
aagctctacaaggccatcgccaagcaccaaaacccccgggatatttatgcggaacggctg
atgtccgaaggcgttatcgatgcggactttgtcaaaaagctggaagaggactacaaagcg
aagctggaggaagaactccgggacagcaagaaggaagataaaacgcggattaccgccttt
atggccgacgaatgggacgggtttgaaaatgtccgggaatgggaaatgatggagccggtg
gaaacaggggtcccgaaggacaagctggaagcggttgcccgggtgattacccaactcccg
gaagacaaaaaattcctgcgcaaggtagacaagctcgtcaaggagcgccacaagatgttc
tttgaaaccaaccgcctggattgggccatgggggagttgctcgcctatggcacgctcctg
caggagggattcgacgtgcggatttccgggcaggacgtggagcgggggacattctcccac
cgccacgcggtgatgaaggtggaagaaagcgaggaagaggtcttgctgctgaaccatatc
tcggaggaacagggcgatttccagatctacaattccctgctttccgagtacggggtggtt
ggattcgaatacgggtacgccatggcgagcccgaacacgctcaccatatgggaagcccag
ttcggggatttcagcaacggcgcccagatcatgatcgaccagtatctctcggcagcggaa
gacaaatggaagttgcagaacggcctggtgcttttcctgccccacggctatgaaggccag
ggtgcggaacactcttcggcccggatggagcgctacctgcaattgtgcgcccgggacaat
atgtatgtggctgatgtcagtaccccggccaacctgtttcacctgctccggcgccagatg
ctggtcaacttccgcaaaccgctggtggttttcaccccgaagagcctgctccggcatgca
aaatgcgtctccacggtagaggaacttgcggaaggccggttccaggaagtgatcgacgat
gccggggcatcggttaaaaaggtcaaatccctggtattctgtacggggaaattttattac
gacctgctcgcagcccgggaggaactgggcagggaggatgtggccctggtccgcctggaa
caattgttcccgctgccggtggtgcagatggaggagcttatcgagaaatattcccatgcg
gaagacctggtttgggcacaggaggaacccaggaacatgggtgcctggagccacctgatg
atgcacttcccggatgcctcgcgtttccgcgtggcttcgcggcgcttttacgcttccccg
gcagcgggcagcccggcgcgctccaagatgcggcaccagcaggtaatcgattatgttttc
gatccgaaaaaagacaatatgagccggccggttcctgcggatgtggcaacggacgaagaa
tga

DBGET integrated database retrieval system