KEGG   Rhodobacter blasticus: B6K69_01400Help
Entry
B6K69_01400       CDS       T05669                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rbl  Rhodobacter blasticus
Pathway
rbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rbl01100  Metabolic pathways
rbl01110  Biosynthesis of secondary metabolites
rbl01130  Biosynthesis of antibiotics
rbl01230  Biosynthesis of amino acids
Module
rbl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B6K69_01400
Enzymes [BR:rbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     B6K69_01400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA TsaE Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: AWD20473
LinkDB All DBs
Position
280831..281391
Genome map
AA seq 186 aa AA seqDB search
MPQLNKTVVMVGMMGAGKTAVGTAVARLLKVPFVDSDDEIVKAASRSIAEIFERDGEPFF
RDREFEVIGRLLRGTPCVLSTGGGAFLSERNRAQIRASGVSVWLRADLELLWQRVRHKTT
RPLLRTANPHETLRTLYEARLPAYEMADLAVDASPDYSIEQMAVRVVEALKTRPDVLDET
AKDDDA
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaactgaacaagaccgtggtcatggtcgggatgatgggggcaggaaagaccgcg
gtcggaacggcagtcgcgcggcttctgaaggtgcccttcgttgattcggatgatgaaatc
gtcaaggccgccagccgcagcatcgccgagattttcgaacgcgatggggaaccctttttc
cgggatcgcgaattcgaggtgatcggccggttgttgcgcggcacgccttgcgtgctgtca
accggcggcggcgcttttctgagcgagcggaaccgtgcccagatccgcgcctcgggcgtc
tcggtctggctgcgcgccgatctggagcttttgtggcaaagggtgcggcacaagacgacg
cgaccactgttgcgcacggcaaatccgcacgaaacgctgcgcacattgtatgaagcaagg
ttgcctgcctatgaaatggccgatcttgccgtcgatgcctcgcctgactactcgatcgag
cagatggcggttcgtgtggtcgaggcgctgaagacccggcccgatgtgctggatgaaact
gcaaaggatgacgacgcatga

DBGET integrated database retrieval system