KEGG   Rhodobacter blasticus: B6K69_07595Help
Entry
B6K69_07595       CDS       T05669                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rbl  Rhodobacter blasticus
Pathway
rbl00020  Citrate cycle (TCA cycle)
rbl00190  Oxidative phosphorylation
rbl00650  Butanoate metabolism
rbl01100  Metabolic pathways
rbl01110  Biosynthesis of secondary metabolites
rbl01120  Microbial metabolism in diverse environments
rbl01130  Biosynthesis of antibiotics
rbl01200  Carbon metabolism
Module
rbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rbl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B6K69_07595
   00650 Butanoate metabolism
    B6K69_07595
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B6K69_07595
Enzymes [BR:rbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     B6K69_07595
    1.3.5.4  fumarate reductase (quinol)
     B6K69_07595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO FAD_oxidored PEARLI-4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AWD23378
LinkDB All DBs
Position
complement(1576741..1578543)
Genome map
AA seq 600 aa AA seqDB search
MTAYPYEVHDYDVVVVGAGGAGLRATLGMAEQGLRTACVTKVFPTRSHTVAAQGGIAASL
GNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQSLKQRAEFYIEYFALDLIITDGRC
TGVVAWKLDDGTIHVFNAKMTVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDME
FVQFHPTGIYGSGCLITEGARGEGGYLTNANGERFMERYAPHYKDLAPRDYVSRCMTLEI
REGRGVGPNKDHIHLNLSHLPRESLELRLPGITESARIFAGVDLHKEPIPVLPTVHYNMG
GIPTNYWGEVLNPTKDNPDAVFPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIR
AGSVVDRNADIGPVNKVEVDKALSRFDALRHANGAIPTAELRLEMQKTMQADAAVFRTEK
TLAEGEVKMTAIAGKMGDLKVTDRSLVWNSDLMETLELTNLMPNALATIYGAHARTESRG
AHAHEDYPARDDANWRKHSLAWVDGNKVTLDYRAVHTDPLTTEDEGGISLKKIAPAERKF
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgactgcttatccgtatgaagtgcatgactatgacgtggtcgtggtgggggctggtggc
gcgggtctgcgcgccacgctgggcatggccgaacagggcctgcgcacggcctgcgtgacc
aaggtcttcccgacccgcagccacaccgttgcggcgcagggcggcatcgcggccagcctt
ggcaacatgggccccgatagctggcagtggcacatgtatgacacggtgaagggcagcgac
tggctgggcgacaccgacgcgatggaataccttgcgcgcgaggcgcccaaggccgtgtac
gagcttgagcactatggcgtgcccttcagccgcaccgaggaaggcaagatctaccagcgc
cccttcggcggccataccaccgaattcggcgaaggcccgccggtgcagcgcacctgcgcc
gccgccgaccgcaccggccacgccatcctgcacacgctttatggccaaagcctcaagcag
cgggccgagttctacatcgaatatttcgcgctggacctgatcatcaccgacgggcgctgc
accggcgtggtggcctggaagctggatgacggcaccattcacgtcttcaacgcgaagatg
acggttctggcgaccggcggctatggccgcgcatatttcagcgccacgtcggcccatacc
tgcaccggcgacggcggcggcatggtggcccgcgccggcctgccgctgcaggacatggaa
ttcgtgcagttccacccgaccggcatctacggttcgggctgtctgatcactgaaggcgcg
cgcggcgaaggcggctacctgaccaacgccaatggcgagcggttcatggaacgctacgcg
ccgcactacaaggatctggccccgcgtgactatgtttcgcgctgcatgacgctggaaatc
cgcgaaggccgcggtgtcggtccgaacaaggaccacatccacctgaacctttcccacctg
ccgcgcgaatcgctggaactgcggctgcccggcatcaccgaaagcgcccgcatcttcgcc
ggcgtcgatctgcacaaggagccgatcccggtcctgccgacggttcattacaacatgggc
ggcatccccaccaactattggggcgaggtgctgaaccccacgaaggacaaccccgacgcc
gtgttccccggcctgatggccgtgggcgaggcgggctgcgccagcgtgcacggggcgaac
cgcctgggttcgaacagcctgatcgacctggtggtcttcggccgcgccgccgcgatccgc
gccggttcggtggtggaccgcaacgccgacatcgggccggtgaacaaggtcgaggtggac
aaggccctgtcgcgctttgacgcgctgcgccatgcgaacggcgccatccccaccgccgag
ctgcgccttgagatgcagaagacgatgcaggccgatgccgccgtgttccgcaccgaaaag
accctggccgaaggtgaggtcaagatgaccgccatcgccggcaagatgggcgatctcaag
gtgaccgaccgcagcctggtctggaacagcgacctgatggaaacgctggaactgaccaac
ctgatgccgaacgcgctggccacgatctatggcgcccatgcccgcaccgaaagccgcggc
gcccatgcgcatgaagattaccccgcgcgcgacgatgccaactggcgcaaacattcgctg
gcctgggttgatggcaacaaggtcacgctggactatcgcgccgtccacaccgacccgctg
acgaccgaggacgagggcggcatcagcctgaagaagatcgccccggcggagcgcaagttc
tga

DBGET integrated database retrieval system