KEGG   Rhodobacter blasticus: B6K69_17750Help
Entry
B6K69_17750       CDS       T05669                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
rbl  Rhodobacter blasticus
Brite
KEGG Orthology (KO) [BR:rbl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B6K69_17750
Enzymes [BR:rbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     B6K69_17750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 AdoHcyase_NAD ADH_N_2 Shikimate_DH Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AWD23676
LinkDB All DBs
Position
pRsa:complement(110761..111828)
Genome map
AA seq 355 aa AA seqDB search
MTMTENRIVRLHGQNDLRLETQPLPAPGPGEVRVAVRAGGICGSDLHYWLEGGIGTIRVR
EPIILGHEAAGVIETLGTGVTGLQVGQLVAMNPSHPCGECAFCRQGLTIHCTAMKFKGSA
MYLPHQQGMFRDLVVIGAGQCHPLPAGTDPGAAACAEPLAVCLHATNRGEAVAGSLAGKV
VLVTGAGPIGALCVAVARQRGAAEIIVTDIQDATLAVARKMGADHAINTLTHPEGLAPWQ
EDKGKVDLVFECSAAAAAIQGAITCLRPRGTLVQVGVAGPTPMPLNVMVGKEILFVGSQR
FDREFADAVALIGAGAIDPRPMITGTWPAEQALAAFDAARDRARSVKVHISFAGA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacggaaaaccggatcgtgcgcctgcacgggcagaatgacctgcggctggaa
acccagcccctgcccgcgcccggcccgggcgaggtgcgggtggccgtgcgtgcgggcggg
atctgcgggtcagacctgcactactggctggaaggcggcatcggcaccatccgcgtccgc
gagccgatcatcctggggcacgaggccgccggcgtgatcgaaacgctgggcacgggcgtc
accgggttacaggtcgggcaactggtggcgatgaacccctcgcatccctgcggagaatgt
gccttctgccgtcagggcctgacgatccattgcacggcgatgaagttcaagggatctgcg
atgtatcttccgcatcagcagggcatgttccgcgatcttgtggtgatcggcgccggccag
tgccatccgctgcccgcaggcaccgacccgggcgccgccgcctgcgccgagccgctggcg
gtctgcctgcacgccaccaaccggggtgaagcggtcgcgggcagccttgcgggcaaggtg
gttctggtcacgggggcgggtccgatcggggcgctttgcgtggcggtcgcccgccagcgg
ggggctgcggaaatcatcgtgaccgacattcaggatgccacgctggccgttgcccgcaag
atgggtgccgatcacgccatcaacaccctgacccatcccgaagggcttgccccctggcag
gaagacaagggcaaggtcgatctggtctttgaatgttcagccgccgccgccgccattcag
ggcgccatcacctgcctgcgtccgcgcggcacgctggtgcaggtcggcgtggccgggcca
acgccgatgcccctgaacgtgatggtgggcaaggaaatcctctttgtcggttcgcagcgg
ttcgaccgcgaattcgccgatgccgtagccctgatcggcgcgggcgccattgacccgcgc
ccgatgatcaccggcacctggcccgccgaacaggcattggccgcctttgacgctgcccgc
gaccgcgcccgctcggtcaaggttcacatttcctttgccggcgcctga

DBGET integrated database retrieval system