KEGG   Rhizobiales bacterium NRL2: TEF_13615Help
Entry
TEF_13615         CDS       T04419                                 

Definition
(GenBank) hypothetical protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
rbm  Rhizobiales bacterium NRL2
Brite
KEGG Orthology (KO) [BR:rbm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TEF_13615
Enzymes [BR:rbm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TEF_13615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 SPOR Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ANK83479
UniProt: A0A192IQL8
LinkDB All DBs
Position
2929156..2930361
Genome map
AA seq 401 aa AA seqDB search
MLAPLLLAAALVLVGLSGPAHAKRQYTGIVVDAATGQVLYDYRPDTLIYPASLTKLMTLY
LTFEALRDGRLGMEQRLPVSQRAAGMPASKLGLKRGGSIKVRDAILSLIVKSANDAAVVL
AESMAKTEILFAREMTEKAQELGMIRTSFRNANGLPNRHQKSTARDISTLALALIRDFPE
YYDLFATRKFTWEGRTYTSTNKLLNGYPGVDGLKTGYINASGFNLAASSVRYGRRLVAVV
IGGQTGARRNRQMKKILGIGFQRALEREKARQLVAMPLPPGRPGTGAPSSALAGIDLSVV
SSAHAAVPPPPARRADDAPYGVQVGAFSSQKRATAGARLAVSAAPTYLQNRPVAIESIPD
TVRSIYRARILELTRDEARETCETLKSKRLDCLVVKAAAGG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgcccctccttctggcggcggcgctggttctcgtcggcctgtccgggccagcg
cacgcaaagcgccagtacaccggcatcgtggtggacgccgcgaccggtcaggtgctctac
gactacaggcccgacacgctcatatatccggcctcgctgaccaagctgatgacgctctat
ctcacgttcgaggcgctgcgggacggccgcctcggcatggaacagcgtctgcccgtatcg
caacgcgccgcgggcatgcccgcctccaagctgggtctgaaacggggcgggtcgatcaag
gtgcgcgacgccatcctttcgctgatcgtcaagtcggccaacgacgctgcggtcgtgctg
gcggaatccatggcgaaaaccgaaatcctgttcgcccgcgagatgaccgagaaggcgcag
gaactgggcatgatccgcaccagcttccgcaacgccaacggcctgcccaaccgccatcag
aaatccaccgcccgcgacatctcgaccctggcgctggcgctgatccgcgacttccccgag
tactatgacctgttcgcgacccggaaattcacctgggaaggccgcacctatacctcgacc
aacaagctgctgaacggctatccgggggtcgacggcctcaagaccggctacatcaacgcg
tccggcttcaacctggcggcctcctcggtgcgttatggccgccggctcgtcgccgtggtg
atcggcggtcagaccggcgcacggcgcaaccggcagatgaagaaaattctcggcatcggt
ttccagcgggcgctcgagcgggaaaaggcgcgacagctcgtcgccatgccgctgcccccg
ggccggcccggaacgggcgcgccgtcctcggcgcttgccggcatcgacctttccgtcgtc
tccagcgcccacgcggcggtaccgccgccgccggcgcggcgcgccgacgacgccccctat
ggcgtccaggtgggcgctttcagttcccagaagcgggcgaccgctggcgcgcgcctcgcc
gtctccgccgcgccgacctatctgcagaaccggccggtggcgatcgaatcgatacccgat
acggtgcgctccatctaccgggcgcggatcctggagctgacccgggacgaggcgcgagaa
acctgcgaaaccctcaagagcaagcgcctcgactgtctggtggtgaaggccgccgccggg
ggctga

DBGET integrated database retrieval system