KEGG   Rubrivivax benzoatilyticus: RBXJA2T_00500Help
Entry
RBXJA2T_00500     CDS       T04092                                 

Definition
(GenBank) ABC transporter iron binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RBXJA2T_00500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbn02000]
    RBXJA2T_00500
Transporters [BR:rbn02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    RBXJA2T_00500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: EGJ08773
UniProt: F3LKA5
LinkDB All DBs
AA seq 341 aa AA seqDB search
MKNWKTTLAVGAVALAAAGQALAQAAPQPVTVYSSRIEQLLKPTLDRYTQETGVRINLLT
DRGGSLTERLAAEGASSPADVLITVDMGNLWNAAERGLLRKLQSPTLDANVPASFRDPGS
RWWGLSQRERTIFYAAGKVQPAQLSTYEDLALPKWKGKLCLRTGKQTYTQSLVAMMIAKH
GEARAEEIARGWVANLATDVFTNDNSLLKAIEAGQCEVGIANTYYYGRILAREPEFNAKV
KLFWANQGAGEGGAHVNLSGGGVTTHARNPEGGRKLLEWLSSQGVQRDYTHGTFESPINP
KAEADPIVQAWGTFKASPLNAADIGSRQAAAIRLLDRVGYR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactggaagacgacgctggccgtcggcgccgtcgcgctcgccgcggccggccag
gccctggcgcaggccgcgccgcagccggtgacggtctactcgtcgcgcatcgagcagctg
ctcaagccgacgctggaccgctacacgcaggagaccggcgtgcgcatcaacctgctgacc
gaccgcggcggctcgctcaccgagcgcctggccgccgaaggcgccagctcgccggccgac
gtgctgatcaccgtcgacatgggcaacctgtggaacgccgccgaacgcggcctgctgcgc
aagctgcagtctccgacgctggacgccaacgtgccggccagcttccgcgaccccggcagc
cgctggtgggggctgtcgcagcgcgaacgcacgatcttctacgccgccggcaaggtgcag
ccggcgcagctgtcgacctacgaggacctggcgctgccgaagtggaagggcaagctctgc
ctgcgcaccggcaagcagacctacacccagtcgctggtggcgatgatgatcgccaagcac
ggcgaggcccgcgccgaggagatcgcgcgcggctgggtcgccaacctcgcgaccgacgtc
ttcaccaacgacaacagcctgctgaaggcgatcgaggccgggcagtgcgaggtcggcatc
gccaacacctactactacggccgcatcctggcgcgcgagcccgagttcaacgccaaggtc
aagctgttctgggccaaccagggcgcaggcgagggcggggcgcacgtcaacctgtccggc
ggcggcgtgaccacgcacgcgcgcaaccccgagggcgggcgcaagctgctcgagtggctg
tcctcgcagggcgtgcagcgcgactacacgcacggcaccttcgagagcccgatcaacccg
aaggccgaggccgacccgatcgtgcaggcctggggcacgttcaaggcgagcccgctgaac
gcagccgacatcggctcgcgccaggccgcggcgatccgcctgctcgaccgcgttggctac
cgctga

DBGET integrated database retrieval system