KEGG   Rubrivivax benzoatilyticus: RBXJA2T_03242Help
Entry
RBXJA2T_03242     CDS       T04092                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rbn  Rubrivivax benzoatilyticus
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rbn03012]
    RBXJA2T_03242
   03029 Mitochondrial biogenesis [BR:rbn03029]
    RBXJA2T_03242
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbn04147]
    RBXJA2T_03242
Translation factors [BR:rbn03012]
 Eukaryotic Type
  Elongation factors
   RBXJA2T_03242
 Prokaryotic Type
   RBXJA2T_03242
Mitochondrial biogenesis [BR:rbn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RBXJA2T_03242
Exosome [BR:rbn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RBXJA2T_03242
  Exosomal proteins of breast cancer cells
   RBXJA2T_03242
  Exosomal proteins of colorectal cancer cells
   RBXJA2T_03242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: EGJ09311
UniProt: F3LLU3
LinkDB All DBs
AA seq 395 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAITTILAAKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETATRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIIKGSAKLAIE
GDKGDLGEQAIFRLADALDSYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGIRPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREEVERGQVLCKPGS
VKPHTHFTAEIYVLSKEEGGRHTPFFNNYRPQFYFRTTDVTGAVELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKII
NT seq 1186 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagggtaagttcgaacgcacgaagccgcacgtgaacgtgggcacgatcgggcac
gtcgaccacggcaagacgacgctgacggcggcgatcacgacgatcctggcggcgaagttt
ggtggtgaagcgaaggcgtacgaccagatcgacgcggcgccggaagagaaggcgcgtggc
atcacgatcaacacggcgcacgtggagtacgagacggcgacgcgtcactacgcgcacgtt
gactgcccggggcacgctgactacgtgaagaacatgatcacgggtgcggcgcagatggac
ggtgcgatcctggtgtgctcggccgctgacggcccgatgccgcagacgcgcgagcacatc
ctgctggcccgtcaggtcggtgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtcgacgacgccgagctgctcgagctcgtcgagatggaagttcgcgaactgctgagcaag
tacgacttcccgggcgacgacacgccgatcatcaagggctcggccaagctggcgatcgaa
ggcgacaagggtgacctgggcgaacaggccatcttccgtctggccgacgcgctggacagc
tacatcccgacgccggagcgcgcggtggacggcacgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcaccgtggtgacgggccgtgtcgaacgcggcgtgatcaag
gtcggcgaggaaatcgagatcgtcggcatccgtccgaccgtcaagacgacctgcacgggc
gtggaaatgttccgcaagctgctggaccaaggtcaggctggtgacaacgtcggcatcctg
ctgcgtggcacgaagcgtgaagaagtcgagcgcggccaggtgctgtgcaagccgggttcg
gtgaagccgcacacgcacttcacggccgagatctacgttctgagcaaggaagaaggcggc
cgtcacacgccgttcttcaacaactaccgcccgcagttctacttccgcacgacggacgtg
acgggcgcggtggagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgccccgatcgcgatggaagaaggcctgcgcttcgccatccgt
gaaggtggtcgcaccgtcggcgccggcgtcgtcgcgaagatcatcg

DBGET integrated database retrieval system