KEGG   Rubrivivax benzoatilyticus: RBXJA2T_11897Help
Entry
RBXJA2T_11897     CDS       T04092                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rbn  Rubrivivax benzoatilyticus
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RBXJA2T_11897
Enzymes [BR:rbn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RBXJA2T_11897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 FAD_oxidored Glutaredoxin FAD_binding_3 DAO K_oxygenase FAD_binding_2 Thi4 NAD_binding_8 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: EGJ11026
UniProt: F3LRQ8
LinkDB All DBs
AA seq 522 aa AA seqDB search
MLDANLKTQLKAYLERLQQPIELVASLDDRPASAEMRALLEDIAPLSALISVRYDGNDAR
RPSFSISRAGADMGVRFAAIPMGHEFTSLVLALLQAGGHPPKLDADTIAQIQGLEGDFVF
ETYMSLTCHNCPDVVQALNLMAVLNPRVRHVAIDGGLFKAEVDARQIMAVPTVFLNGQPF
GSGRMEIGEILAKVDTGAAARDAAKLAKKEPYEVLIVGGGPAGAAAAIYAARKGIRTGIV
AERFGGQTLDTLAIENFVSVMETEGPKFAAALEAHVRAYAVDVNVGQQVQAVVPAPQPGA
HATVKLANGAELKGRTVILATGARWRNVNVPGEQEYKTRGVAYCPHCDGPLFKGKKVAVI
GGGNSGVEAAIDLAGVVEHVTLIEFLDQLKADAVLVDKLKSLPNVTIHTNAQTTEITGDG
QKVNGLRYKDRVSGAEHHVELAGVFVQIGLVPNTEFLKGTLELSRFGEIVIDPKCATSVP
GIFAAGDVTTVPYKQIIIATGEGAKAALSAFDYLIRTPAEQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacctcaagacccagctcaaggcctacctggagcgcctgcagcagccg
atcgaactcgtcgcctcgctcgacgaccgcccggcctcggccgagatgcgggcgctgctc
gaggacatcgcgccgctgtcggcgctgatcagcgtgcgctacgacggcaacgacgcgcgc
cgcccgtcgttctcgatcagccgcgctggcgccgacatgggcgtgcgtttcgcggccatc
ccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggccggcggccacccg
cccaagctcgacgccgacacgatcgcgcagatccagggcctggaaggcgacttcgtcttc
gagacctacatgtcgctgacctgccacaactgccccgacgtcgtgcaggcgctgaacctg
atggcggtgctgaacccgcgcgtgcgccacgtcgcgatcgacggcggcctgttcaaggcc
gaggtcgacgcgcgccagatcatggccgtgccgacggtgttcctgaacggccagcccttc
ggctcgggccgcatggagatcggcgagatcctggccaaggtcgacaccggcgccgccgcg
cgcgacgccgccaagctggcgaagaaggagccgtacgaggtgctgatcgtcggcggcggc
ccggccggcgccgcggcggcgatctacgccgcgcgcaagggcatccgcaccggcatcgtc
gccgaacgtttcggcggccagacgctggacacgctggccatcgagaacttcgtctcggtg
atggagaccgaagggccgaagttcgccgccgcgctggaagcccacgtgcgcgcctacgcc
gtcgacgtcaacgtcggccagcaggtgcaggccgtggtcccggcgccgcagccgggcgcc
cacgcgacggtcaagctggccaacggcgccgagctgaaggggcgcacggtgatcctggcc
accggcgcgcgctggcgcaacgtcaacgtgcccggcgagcaggagtacaagacccggggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagaaggtcgccgtcatc
ggcggcggcaactccggcgtcgaggccgcgatcgatctcgccggcgtcgtcgagcacgtg
acgctgatcgagttcctcgaccagctgaaggccgacgcggtgctggtcgacaagctcaag
agcctgcccaacgtcacgatccacaccaacgcgcagacgaccgagatcaccggcgacggc
cagaaggtcaacggcctgcgctacaaggaccgtgtctcgggcgccgagcaccacgtcgaa
ctggccggcgtgttcgtgcagatcggcctcgtgcccaacaccgagttcctgaagggcacg
ctggagctgagccgcttcggcgagatcgtcatcgacccgaagtgcgcgaccagcgtgccg
ggcatcttcgccgccggcgacgtgacgaccgtgccgtacaagcagatcatcatcgccacc
ggcgaaggcgcgaaggcggcgctgtcggccttcgactacctgatccgcacgccggccgag
cagggctga

DBGET integrated database retrieval system