KEGG   Rubrivivax benzoatilyticus: RBXJA2T_12157Help
Entry
RBXJA2T_12157     CDS       T04092                                 

Definition
(GenBank) ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
rbn  Rubrivivax benzoatilyticus
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rbn03016]
    RBXJA2T_12157
Enzymes [BR:rbn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     RBXJA2T_12157
Transfer RNA biogenesis [BR:rbn03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    RBXJA2T_12157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: EGJ11078
UniProt: F3LRW0
LinkDB All DBs
AA seq 671 aa AA seqDB search
MTYALFDDAGKFHAGRVMSEAESSMQIELDSGKRVKVKAANVLLRFEKPAPAELIAQAQA
LAAEIDLDLAWEFAPEGEFGFADLARDYFEASAGPDKQAAALFRLFEAPHYFRRLGKGLF
RKAPEETVKAALLGIERKKQLAAQIEAWAGEIAAGQCPAPVREQLYKILFRPDKNAPEYK
AVVEAAKRTQRAPLDLLKDAGAIDSPYQFHWRRFLFETFPQGTGFPALAAPAIKEELPLA
AVQAFSIDDSQTTEIDDALSVQGLGTGTVIFGIHIAAPGLAIQPDSPVDKVARDRLSTVY
MPGWKITMLPDEVVQAYTLIEGRDCPAVSLYATVDEATFEVRAVETKLERVPIVANLRHD
QLDDVITEASLAGEAPADYAFATELAFCWRFAQALKAAREVVRGKPENFNRPDYNFRLEG
HTAEPDGSERVQITTRRRGAPLDLIVSEAMILANSRWGGWLAECGVPGIYRSQASLLPGI
KVRMGTKPAPHAGMGVAQYTWATSPLRRYVDLVNQWQIIACARHGRTAALAAPFRPKDAS
LFSVISGFDAAYSAYNDFQHGIERFWTLRWIEQNAVTELEAAVMKGGLVRAETLPLVFRV
PGTEDWPRGARLRARVAGIDLLTLDLHATLVARIEDEPPEAVAEVDDEAEAVGPLTLAID
VNDAPAGDAGA
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
gtgacttatgccctgttcgacgacgccgggaaattccacgccggccgcgtgatgtccgaa
gccgagagctcgatgcagatcgagctcgattccggcaaacgcgtgaaggtgaaggcggcc
aacgtgctgctgcgcttcgagaagccggccccggccgagctgatcgcccaggcgcaggcg
ctggcggcggaaatcgacctcgacctcgcctgggagttcgcgcccgaaggtgaattcggt
ttcgccgacctggcgcgcgactatttcgaggcctcggccggccccgacaagcaggccgcg
gcgctgttccgcctgttcgaggcgccgcactacttccgccgcctcggcaagggcctgttc
cgcaaggcacccgaggagaccgtcaaggcggcgctgctgggcatcgagcgcaagaagcag
ctcgcggcgcagatcgaggcctgggccggcgagatcgccgccggccagtgcccggcgccg
gtgcgcgagcagctctacaagatcctgttccgccccgacaagaacgcgcccgagtacaag
gccgtcgtcgaggccgccaagcgcacgcaacgcgcaccgctggacctgctgaaggacgcc
ggcgcgatcgacagcccgtaccagttccactggcggcgtttcctgttcgagaccttcccg
cagggcaccggcttcccggcgctggcggcgccggcgatcaaggaagagctgccgctggcc
gcggtgcaggccttctcgatcgacgactcgcagacgaccgagatcgacgacgcactgtcg
gtccagggcctgggcaccggcacggtgatcttcggcatccacatcgccgccccggggctg
gcgatccagccggactcgccggtggacaaggtcgcgcgcgaccgcctgtccaccgtctac
atgccgggctggaagatcacgatgctgcccgacgaggtcgtgcaggcctacacgctgatc
gagggccgcgactgcccggccgtcagcctgtacgcgacggtcgacgaggccacgttcgag
gttcgcgcggtcgagaccaagctcgaacgcgtgccgatcgtcgccaacctgcgccacgac
cagctcgacgacgtcatcaccgaggcgtcgctggccggcgaggcgccggccgactacgcc
ttcgccaccgagctggccttctgctggcgcttcgcgcaggcgctgaaggcggcgcgcgag
gtcgtgcgcggcaagcccgagaacttcaaccgcccggactacaacttccgcctcgaaggc
cacacggccgagcccgacggcagcgaacgtgtgcagatcacgacgcgccggcgcggcgcg
ccgctggacctgatcgtctccgaggcgatgatcctggccaacagccgctggggcggctgg
ctcgccgaatgcggcgtgccgggcatctaccgcagccaggccagcctgctgcccggcatc
aaggtgcgcatgggcaccaagccggcgccgcacgccggcatgggcgtggcgcaatacacc
tgggccacgtcgccgctgcggcgctacgtcgacctcgtgaaccagtggcagatcatcgcc
tgcgcgcgccacggccgcaccgcggcgctggccgcgccgttccggcccaaggacgcatcg
ctgttctcggtgatctcgggcttcgacgccgcctactcggcctacaacgacttccagcac
ggcatcgagcgtttctggacgctgcgctggatcgagcagaacgccgtcaccgagctggag
gccgcggtgatgaagggcggcctggtgcgcgccgagacgctgccgctggtcttccgcgtg
cccggcaccgaggactggccacgcggcgcgcggctgcgcgcccgtgtcgccggcatcgac
ctgctgacgctggacctgcacgcgacgctcgtcgctcgcatcgaggacgaaccgcccgag
gcggtcgccgaggtcgacgacgaagccgaagccgtcggcccgctgacgctggccatcgac
gtcaacgacgcccccgccggagatgctggcgcttaa

DBGET integrated database retrieval system