KEGG   Rubrivivax benzoatilyticus: RBXJA2T_13189Help
Entry
RBXJA2T_13189     CDS       T04092                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RBXJA2T_13189
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rbn02000]
    RBXJA2T_13189
Enzymes [BR:rbn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RBXJA2T_13189
Transporters [BR:rbn02000]
 Other Transporters
  Pores ion channels [TC:1]
   RBXJA2T_13189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: EGJ11284
UniProt: F3LSG6
LinkDB All DBs
AA seq 224 aa AA seqDB search
MIVVHHLENSRSQRVLWLLEELGLAYEVKRYERDRETMLAPPELKRVHPLGKSPVIVDGA
VTVAETGAIVEYLLDTYDPEGRLRPPPATEARRRFTYWLHFAEGSAMPPLLMKLVFDRVR
SAPVPFFIKPVVKGIADKVTGSFIAPNIAAQLAFMEAELSARPWFAGEAFSAADVMMSFP
LEAAAARAGLDARYPKLQDWLKRVHARAAYGRALERGGPYSIIG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtccaccacctggagaactcgcgctcgcagcgtgtgctgtggctgctcgag
gaactgggcctggcttacgaagtgaagcgctacgagcgcgaccgcgaaacgatgctcgcg
ccgccggaactgaagcgtgtgcacccgctgggcaagtcgccggtgatcgtcgacggcgcg
gtgacggtggccgagaccggcgccatcgtcgagtacctgctcgacacctacgaccccgaa
ggccgcctgcgcccgccgccggccaccgaggcgcgccggcgcttcacctactggctgcac
ttcgccgaaggcagcgcgatgccgccgctgctgatgaagctggtcttcgaccgcgtgcgc
agcgcgccggtgccgtttttcatcaagcccgtcgtcaagggcatcgccgacaaggtgacc
ggcagtttcatcgcgccgaacatcgccgcgcagctggccttcatggaagccgaactgagc
gcccgcccctggttcgccggcgaggccttcagcgccgccgacgtgatgatgagcttcccg
ctcgaagccgcggcggcccgcgccgggctcgacgcccgctatccgaagctgcaggactgg
ctgaagcgcgtgcacgcgcgtgccgcctacggccgggcgctggagcgtggcgggccgtat
tcgatcatcggctga

DBGET integrated database retrieval system