KEGG   Rubrivivax benzoatilyticus: RBXJA2T_18708Help
Entry
RBXJA2T_18708     CDS       T04092                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rbn  Rubrivivax benzoatilyticus
Pathway
rbn00630  Glyoxylate and dicarboxylate metabolism
rbn00710  Carbon fixation in photosynthetic organisms
rbn01100  Metabolic pathways
rbn01120  Microbial metabolism in diverse environments
rbn01200  Carbon metabolism
Module
rbn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rbn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rbn_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RBXJA2T_18708 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RBXJA2T_18708 (rbcL)
Enzymes [BR:rbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RBXJA2T_18708 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: EGJ12381
UniProt: F3LVL3
LinkDB All DBs
AA seq 493 aa AA seqDB search
MNKPHEPGATGDQILDKKQRYSAGVLKYRQMGYWDSDYVPKPTDVVCLFRITPQEGVDPI
EAAAAVAGESSTATWTVVWTDRLTACDSYRAKAYKVEPVPGRPGEFFAWVAYDLILFEEG
SIANMTASLIGNVFSFKPLKAARLEDIHIPVAYVKTFKGPPTGLVVERERLDKFGRPLLG
ATTKPKLGLSGRNYGRVIYEGLKGGLDFMKDDENINSQPFMHWRDRFLYVMDGVNKASAA
TGEVKGSYLNITAATMEDMYERAEFAKELGSVVVMVDLVIGWTAIQSIANWARKNDMIVH
MHRAGHGTYTRQKNHGVSFRVIAKWLRLAGCDHLHTGTAVGKLEGDPLTVQGYYNVCRDS
YTKQDLPRGLFFDQDWADLRKVMPVASGGIHAGQMHQLIDLFGDDVILQFGGGTIGHPAG
IQAGAVANRVALEAMVKARNEGKDIKNEGPEILQKAAQFCTPLKQALDTWKDVSFNYAST
DQSDYAVTPATSA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccccacgaacccggcgccaccggggaccagatcctcgacaagaagcagcgc
tacagcgccggcgtgctgaagtaccgtcagatgggttactgggacagcgactacgtgccc
aagcccaccgatgtcgtctgcctgttccgcatcacgccgcaggaaggcgtggacccgatc
gaggccgccgccgcggtggccggcgaatccagcaccgcgacctggaccgtggtctggacc
gaccgcctgaccgcctgcgacagctaccgcgccaaggcctacaaggtcgagccggtgccg
ggccggcccggcgagttcttcgcctgggtggcctacgacctgatcctgttcgaagaaggc
tcgatcgcgaacatgaccgcgagcctgatcggcaacgtcttcagcttcaagccgctgaag
gccgcgcgcctggaggacatccacatcccggtcgcctacgtgaagaccttcaagggcccg
ccgaccggcctggtcgtcgagcgcgagcgcctggacaagttcggccgcccgctgctgggt
gcgacgaccaagcccaagctcggcctgtcggggcgcaactacggccgcgtgatctacgaa
ggcctgaagggcggcctggacttcatgaaggacgacgagaacatcaactcgcagcccttc
atgcactggcgtgaccgcttcctctacgtgatggacggcgtgaacaaggccagcgccgcc
accggcgaggtcaagggcagctacctgaacatcaccgccgcgacgatggaggacatgtac
gagcgtgccgagttcgccaaggaactgggctcggtcgtcgtgatggtcgacctggtgatc
ggctggacggcgatccagagcatcgccaactgggcgcgcaagaacgacatgatcgttcac
atgcaccgcgccggccacggcacctacacccgccagaagaaccacggcgtgagcttccgc
gtcatcgccaagtggctgcgcctggccggctgcgaccacctgcacaccggcaccgccgtc
ggcaagctcgagggcgacccgctgaccgtgcagggctactacaacgtctgccgcgacagc
tacaccaagcaggacctgccgcgcggcctgttcttcgaccaggactgggccgacctgcgc
aaggtgatgccggtggcctcgggcggcatccacgccggccagatgcaccagctgatcgac
ctgttcggcgacgacgtgatcctgcagttcggcggcggcacgatcggccacccggcgggc
atccaggccggtgcggtcgccaaccgcgtcgcgctggaagcgatggtgaaggcgcgcaac
gaaggcaaggacatcaagaacgagggcccggagatcctgcagaaggcggcccagttctgc
accccgctgaagcaggcgctggacacctggaaggacgtgtcgttcaactacgcgagcacc
gaccagtccgactacgccgtgacgcccgccacctccgcctga

DBGET integrated database retrieval system