KEGG   Ruminococcaceae bacterium CPB6: B6259_02405Help
Entry
B6259_02405       CDS       T04880                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rbp  Ruminococcaceae bacterium CPB6
Brite
KEGG Orthology (KO) [BR:rbp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rbp03012]
    B6259_02405
   03029 Mitochondrial biogenesis [BR:rbp03029]
    B6259_02405
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rbp04147]
    B6259_02405
Translation factors [BR:rbp03012]
 Eukaryotic Type
  Elongation factors
   B6259_02405
 Prokaryotic Type
   B6259_02405
Mitochondrial biogenesis [BR:rbp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B6259_02405
Exosome [BR:rbp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B6259_02405
  Exosomal proteins of breast cancer cells
   B6259_02405
  Exosomal proteins of colorectal cancer cells
   B6259_02405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ARP49845
UniProt: A0A1W6WC91
LinkDB All DBs
Position
501034..502236
Genome map
AA seq 400 aa AA seqDB search
MAKEKFDRSKAHVNIGTIGHVDHGKTTLTAAITKVLALKGEASFKDYASIDAAPEERERG
ITINTAHVEYTTDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVYMNKCDQVDDPELLDLVEMEIRDLLNEYGFPGDTTPIVRGSALKALE
CDSKDINAPEYKSIVDLMNIVDDYIPTPDRKSDQPFLMPVEDVFTITGRGTVATGRVERG
MAKIGDEVEIIGLTDERKKSVITGLEMFRKTLDYAEAGDNIGALLRGIQREDIERGQVIA
KPGTIHPHTKFRGQVYVLTKDEGGRHTPFFNNYRPQFYFRTTDVTGVISLPEGTEMCMPG
DNVEMSVELIAPIAIEKGLRFSIREGGHTVGSGVVSDICD
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaaaaattcgacagatctaaggcacacgtgaacattggtaccatcggccat
gttgaccatggtaaaacaaccctgactgctgcgattaccaaggtgcttgcactgaaaggt
gaagcaagcttcaaggattatgccagcatcgatgccgctcctgaagagcgtgagcgcggc
attaccattaacacggctcatgttgagtacaccacagataagcgtcactacgctcatgtt
gactgccccggccatgctgactatgtcaagaacatgattaccggtgctgcacagatggat
ggtgctattctggttgtttccgctgctgatggcccgatgccgcagacccgtgagcatatc
ctgcttgcccgtcaggttggtgtgccttatatcgttgtctatatgaacaaatgcgaccag
gttgatgaccctgagttgctggaccttgttgaaatggaaattcgtgacctgctcaacgag
tacggcttcccgggagacactactccaatcgtacgcggttctgcactgaaagctctggag
tgcgattccaaagatatcaatgcaccggagtacaagagcattgttgacctgatgaacatt
gtcgatgactacatcccgactcctgaccgtaagtctgatcagccgttcctgatgcctgtt
gaagacgtattcaccatcaccggccgtggtactgttgctactggccgtgttgagcgtggt
atggctaaaatcggcgatgaagttgaaatcatcggtctgactgatgagcgtaagaagagc
gttatcaccggtctggaaatgttccgcaaaactctggattacgcagaggctggcgataac
atcggtgctctgctgcgtggtattcagcgtgaagacatcgaacgtggacaggttattgca
aagcctggcactattcatccgcataccaagttcagaggtcaggtttatgttctgactaag
gatgaaggcggccgccatactcctttcttcaacaactaccgtccgcagttctatttccgt
acaactgatgtcaccggcgttatctctctgccggaaggcactgagatgtgcatgcctggc
gataacgttgaaatgtccgttgaactgattgccccaatcgctattgaaaagggcctccgc
ttctccattcgtgaaggcggtcataccgttggttccggcgttgtttccgacatctgtgac
taa

DBGET integrated database retrieval system