KEGG   Ruminococcaceae bacterium CPB6: B6259_03570Help
Entry
B6259_03570       CDS       T04880                                 

Definition
(GenBank) restriction endonuclease
Organism
rbp  Ruminococcaceae bacterium CPB6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII NERD
Motif
Other DBs
NCBI-ProteinID: ARP50035
UniProt: A0A1W6WCR0
LinkDB All DBs
Position
complement(732354..733199)
Genome map
AA seq 281 aa AA seqDB search
MRDFNTWLGKMRPSINNYGYYVDFQKVYDNVDSIKVELNIMNSLIGSADIENEFRTLLAK
YPEILKCIPTLLAVRQSEIYAQDEDGAFLYDFNKLNYSVEQYIVFMKKTGLLDLIANHLV
NNLVDYALGIETGLDSNGRKNRGGHQMENLVESFIRKANVEYYKEMYLTDIEKKWNVDLS
AISAGGTSTKRWDFVVITATHIYVIETNFYASGGSKLNETSRSYKMIAEEANQIEGVDFV
WITDGGGWRSARRNLEETFNTMTHLYNIADMEDGIFLSLFV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagagatttcaatacttggcttggaaagatgcgtccgagtattaacaactatgggtat
tacgttgatttccaaaaagtgtacgataacgtcgactcaattaaggtcgaactcaatatc
atgaattcgcttattggctctgctgatatagagaacgagtttcgtacccttcttgctaaa
tatcctgagattcttaaatgtataccaacattgttagctgtccgacaaagtgaaatctat
gctcaggatgaagatggcgcgtttctttatgatttcaacaagcttaactattctgtagaa
caatatatagtttttatgaaaaagaccgggttattagatttaatagctaatcatcttgtc
aacaatttggttgattatgctcttgggatagaaacaggccttgatagtaatggaagaaaa
aatcgtggcggccaccagatggaaaaccttgtagagagctttatccgcaaagcaaacgtc
gagtattacaaagagatgtacctaacggatattgagaaaaaatggaatgtagatctttct
gctatttcagcggggggcacatcaacaaaacgatgggattttgttgttataacagcgact
catatttatgtcatcgaaacaaacttctatgcaagtggaggctcaaaactcaacgagact
tctcgaagctataagatgatcgcggaagaagcaaatcaaattgaaggagtcgattttgta
tggatcactgatggcggcggctggcgaagtgcccgacgaaaccttgaggagacttttaat
actatgactcatctgtataacattgcagatatggaggatgggatctttttgtcgttgttc
gtgtga

DBGET integrated database retrieval system