KEGG   Ruminococcaceae bacterium CPB6: B6259_07015Help
Entry
B6259_07015       CDS       T04880                                 

Definition
(GenBank) glycosylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rbp  Ruminococcaceae bacterium CPB6
Pathway
rbp00500  Starch and sucrose metabolism
rbp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B6259_07015
Enzymes [BR:rbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B6259_07015
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     B6259_07015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF4434 hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: ARP50647
UniProt: A0A1W6WEG7
LinkDB All DBs
Position
1424913..1426460
Genome map
AA seq 515 aa AA seqDB search
MPKWLNDAVFYEIYPQSFYDTNGDGIGDINGITEKLDYIKSLGCNAIWINPCFESPFMDA
GYDISDYKKVAPRYGTNDDLKHCFNEAHKRGMHILLDLVPGHTSDKHQWFRESQKACQNE
YTNRYIWTDSVWNRPAGFNSMCGVSEKDGCYLLNFFSSQPALNYGFNKITAPWQMHYTQP
DCVATREALKDVMRFWLDAGCDGFRVDMADSLVKNDDNKEATCEVWRNIRGMLNREYPEA
AMVSEWSDPAKAIGKAQFDMDFYLDHQENGYHALFRKTGSDGSQQNFFSKQGNGDIMEFL
DDYLPRYHVAESAGYVSMMTCNHDTPRMTLGFDELECKIAYAFLLTMPGVPFIYYGDEIG
IQYFRLNSVEGGYHRTGTRTPMQWTNGKNLGFSTAEKEKLYLPVDERDCAPTVESQNKDT
NSLLNTVRKVLKLRHENPDLQAQPNFEVVYAEKGKYPFVFRRGQFLIAVNPSWRSVSIPM
KLLGESIFQLGHSTLENGNLSMKGQSFSIFHMNSI
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatggctgaatgacgcagtattttatgaaatttatccgcaaagtttttatgac
acaaatggtgatggtattggagatataaacggcataacagaaaagctcgattatatcaaa
tctttgggatgcaatgcaatctggattaacccctgctttgaatccccctttatggacgcg
ggctatgatataagtgattataaaaaggttgccccgcgttacggcacaaacgatgactta
aagcactgctttaacgaagcacacaaacgtggaatgcatatcctgcttgatttggtgccc
ggtcacacctctgataaacaccagtggtttcgggaaagccagaaagcatgccaaaatgaa
tatacaaaccggtatatttggactgactccgtgtggaaccgccccgccggattcaacagt
atgtgcggggtcagcgaaaaggacggctgctatttgctgaatttcttttcgtcccagccg
gcgctcaactatgggttcaataaaataaccgcaccatggcaaatgcattacacccagcct
gactgcgttgcaacacgggaagccctgaaagatgtaatgcgcttttggctggatgcgggc
tgcgacggtttccgagtggatatggcggattcgttggtaaaaaacgatgataataaagag
gcaacctgcgaagtatggagaaacatccgtgggatgcttaaccgggagtatccggaagct
gccatggtatcagaatggtcagaccctgctaaggcgattggaaaagcccagtttgatatg
gacttttatttggaccatcaggaaaatggataccatgcactattccgcaagacaggcagc
gacggcagccaacagaactttttcagcaagcagggcaatggcgatattatggagtttctg
gatgattatctgccgcgatatcatgtggcggaatcagcaggttacgtcagtatgatgacc
tgcaaccatgataccccccgcatgacacttggctttgatgaattggaatgtaaaattgcc
tatgcttttctattgaccatgccgggggttcctttcatttactacggtgatgaaatcggc
atacagtattttcggcttaacagtgttgaaggcgggtatcatcgtaccgggacgcgtacg
cccatgcagtggacaaatggaaagaatcttgggttttccaccgcagaaaaagaaaaactg
tatttgccggtggatgaaagagattgtgcaccgacagtggaaagccagaacaaggatacc
aattctctgctgaatacggttcgaaaagttctaaaactacgccacgaaaatccagatttg
caggcacagccgaattttgaagtcgtttatgcagaaaaaggaaaatatccatttgtgttc
cgccgcggtcagtttttaatagcggtcaatccgtcgtggcggtcggtatcaataccgatg
aagctgcttggtgaatcgatattccagcttggtcacagcacattagaaaacggtaacctt
tctatgaaaggtcagtctttttcaatatttcatatgaattcaatttga

DBGET integrated database retrieval system