KEGG   Ruminococcaceae bacterium CPB6: B6259_08970Help
Entry
B6259_08970       CDS       T04880                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rbp  Ruminococcaceae bacterium CPB6
Pathway
rbp00473  D-Alanine metabolism
rbp00550  Peptidoglycan biosynthesis
rbp01100  Metabolic pathways
rbp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rbp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B6259_08970
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B6259_08970
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B6259_08970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rbp01011]
    B6259_08970
Enzymes [BR:rbp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B6259_08970
Peptidoglycan biosynthesis and degradation proteins [BR:rbp01011]
 Precursor biosynthesis
  Amino acid ligase
   B6259_08970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 Synapsin_C
Motif
Other DBs
NCBI-ProteinID: ARP50989
UniProt: A0A1W6WFE6
LinkDB All DBs
Position
1806737..1807816
Genome map
AA seq 359 aa AA seqDB search
MMKKTVAVLFGGSSSEHEVSCVSAATIAENLNKDKYDVLTLGITKDGRWLLYSGSTDSIR
SGAWETDTAACRRACISPDTSVHGIVTEGPDGFQTIHVDCVIPALHGKNGEDGTIQGLLH
VSGIPYVGCPTLASACCMDKAVTHTLLASWNIKQAHFLWFFAENYSGEGRLKIQRKIDAR
LGWPIFLKPANAGSSVGISKVKSTDELDAAVALAALQDSKIVVEEAIDGQEVECAVLGNE
CPQASIVGEIGAGAEFYDYDDKYKNGKSQLYIPAHLDAPVADELRHIACRAYRLLGCTGL
ARVDFFVRGGKEVLLNELNTLPGFTAISMYPKLWEACGKPIAQLLDELISLAEERKRYM
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
attatgaagaaaacagtagcagttctgtttggcggcagctcatccgagcacgaagtgtcc
tgtgtttcggcggccaccattgcggaaaacctaaacaaagataaatacgacgttttaaca
ctgggcatcaccaaagacggacgctggcttctttacagcggttccaccgattccatccgt
tccggcgcatgggaaacggacaccgccgcgtgccgccgtgcctgtatttcaccggacact
tccgtacacggcatcgtaaccgagggaccggacggcttccagaccattcatgtggactgc
gtcattcccgccctgcacggcaaaaacggcgaggacggcaccattcagggccttctgcac
gtcagcggcattccgtatgtcggctgccccactttggcaagtgcctgctgcatggacaaa
gccgtcacccacaccctgctggccagctggaatatcaagcaggcacattttctatggttt
tttgccgaaaattacagcggtgagggccgtctgaaaatccagcgtaaaattgacgcccgc
ctcggctggcctatcttcctgaagcccgccaatgccggctccagtgttggcatctctaaa
gtaaaaagtaccgatgagctggacgccgccgttgcccttgcagccctgcaggacagcaaa
atcgttgtggaagaagccatcgatgggcaggaagtggagtgcgccgttttgggcaacgaa
tgcccgcaggccagcatcgtcggcgaaatcggcgctggcgcggaattttatgactatgac
gataagtacaaaaacggcaagagtcaactgtacattccggcacatctggacgcccctgtt
gccgatgaactgcggcacattgcctgccgtgcctaccggctgctgggctgcaccggcctt
gcccgtgtggactttttcgtgcgcggcggcaaagaggttctgctgaatgaactgaacaca
ctgcccggctttaccgccatcagtatgtaccccaagctgtgggaagcctgcggcaagccg
atcgcccagctgctggacgaactcatctctctggccgaagaacgcaaacgctatatgtga

DBGET integrated database retrieval system