KEGG   Ruminococcus bromii: RBR_06310Help
Entry
RBR_06310         CDS       T02599                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rbr  Ruminococcus bromii
Pathway
rbr00473  D-Alanine metabolism
rbr00550  Peptidoglycan biosynthesis
rbr01100  Metabolic pathways
rbr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rbr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RBR_06310
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RBR_06310
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    RBR_06310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rbr01011]
    RBR_06310
Enzymes [BR:rbr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RBR_06310
Peptidoglycan biosynthesis and degradation proteins [BR:rbr01011]
 Precursor biosynthesis
  Amino acid ligase
   RBR_06310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK GARS_A ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CBL15000
LinkDB All DBs
Position
678192..679259
Genome map
AA seq 355 aa AA seqDB search
MRIVVLAGGLSTEREVSISSGTLVAEALRSKGHEVVLLDVFMGYEENICDIDALFKQNYS
FTDGNSIGDDVENTITNIKEAKENRLDKTSRYIGRNVIEICAEADITFLALHGGEGENGQ
LQATLDLFGIKYTGSGYLGSALAMNKGLTKSVFMQKNINTPSGELYKNEKDALAWNMFPC
IVKPCSGGSSVGVSKVENADQYKKAVKEALKYEDEIVVEQFVTGREFSVGLIGGKALPPI
EIAPKSGMYDYAAKYQAGATVETCPADIDEETDKKLRDAATEAYEALHLESYARIDFLLD
KGGFTYCLEANTLPGMTPTSLLPQEAAVEGISYPDLCEKIIEISLAKYPEEKSDF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagaatagttgttcttgcaggcggactgagcacagagcgtgaagtttcaatttcatca
ggcacacttgttgccgaggctctcagaagcaagggacacgaggttgttttgcttgatgta
tttatgggctatgaggaaaatatctgtgacattgacgcacttttcaagcagaactacagc
tttaccgacggaaattcaatcggtgacgatgttgaaaatacaatcacaaatatcaaagag
gcaaaggaaaatcgccttgacaaaacatcacgctatatcggcagaaatgtaattgaaatc
tgcgccgaggcagacatcactttccttgcacttcacggcggtgagggtgaaaacggtcag
ttacaggcaacgcttgatttgttcggaatcaagtacacaggttcgggatatctcggttct
gcgcttgcaatgaacaaaggtcttacaaaaagcgtatttatgcagaagaatatcaacact
ccgtcaggtgaactttacaagaacgaaaaggacgctcttgcatggaatatgttcccgtgc
atcgttaagccatgctcgggcggttcaagcgtgggcgtttcaaaggttgagaatgcagat
cagtataaaaaggctgttaaagaggctctcaaatatgaggacgaaattgttgttgagcag
ttcgtaacaggcagagaattttccgtcggtcttatcggcggcaaggcacttccgccgatt
gagattgctcctaagtcgggaatgtacgattatgccgcaaaatatcaggcaggcgcaaca
gttgaaacctgtccggcagacattgacgaagaaaccgacaaaaagctccgtgatgccgca
acagaggcatacgaggcacttcaccttgaaagctatgcacgaatcgactttcttcttgac
aagggcggttttacatactgcctcgaggcaaacactctccccggcatgactcccacaagc
ctccttcctcaggaggcggctgttgagggtataagctatcccgatttgtgcgaaaagatt
attgaaatttcacttgcaaaatatcccgaagaaaaatctgatttttaa

DBGET integrated database retrieval system