KEGG   Rhodobiaceae bacterium SMS8: RHODOSMS8_00930Help
Entry
RHODOSMS8_00930   CDS       T05596                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rbs  Rhodobiaceae bacterium SMS8
Pathway
rbs00010  Glycolysis / Gluconeogenesis
rbs00020  Citrate cycle (TCA cycle)
rbs00620  Pyruvate metabolism
rbs01100  Metabolic pathways
rbs01110  Biosynthesis of secondary metabolites
rbs01120  Microbial metabolism in diverse environments
rbs01130  Biosynthesis of antibiotics
rbs01200  Carbon metabolism
Module
rbs_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHODOSMS8_00930 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RHODOSMS8_00930 (pdhC)
   00620 Pyruvate metabolism
    RHODOSMS8_00930 (pdhC)
Enzymes [BR:rbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RHODOSMS8_00930 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N DUF2118 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AWZ00480
UniProt: A0A2Z4UHS5
LinkDB All DBs
Position
947119..948387
Genome map
AA seq 422 aa AA seqDB search
MPIPILMPALSPTMEEGTLAKWLVKEGDEVRSGDLIAEIETDKATMEVEAVDEGTVGKLL
VAEGTEGVPVNEPIAVILEEGEDASAAENLAAPTSAPAAPAEKSPAPDTKPAKAADAPAP
AKEKPAGGRVFASPLAKRIAKDKGIDLSAVTGSGPRGRIVKVDVEAAPKTPVRAAGKAPT
AMSSIDARAFYEEGTYNEIPLNSMRKTIARRLTQSKQEIPHYYLTIDCVLDELLKVRKHL
NAEGADAGVKLSVNDFIVRAAALALKKVPEANVSFADDALLQHHHSDVGIAVALEGGLIT
PIIRRADEKGLAEISAEAKELAARARDKKLSPAEFEGGSFSVSNLGMFGIKNFTAVINPP
QAAIMAVGAGEPRPIIVDGEVKAATVMTVTLSCDHRAIDGALGAQLLAAFKSYIEYPPSM
LL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccaataccaattctcatgcccgctctctcccctacgatggaagagggcacattagcc
aaatggctggtgaaagaaggtgatgaggtgcgctccggcgaccttattgctgagattgaa
accgacaaggcgaccatggaagtggaagccgttgatgaaggaactgtgggcaagcttctg
gtggccgaaggtacagaaggcgtgccggtcaacgagcccattgctgtgatcctggaagag
ggtgaggatgccagtgccgctgagaacctcgcagcaccaacgtcagcgcccgctgcacct
gcagaaaaaagtcctgcgccagacaccaagcctgcaaaagccgcagacgcacccgcgcca
gcgaaagaaaaaccggcgggtgggcgagtattcgcaagccctttggcgaagcgcattgct
aaagataaaggcattgatctctctgctgtcacagggagcggcccacgcggccgcattgtg
aaggtggatgtcgaagccgcacctaaaacacccgtccgtgcagcgggcaaagccccgaca
gcaatgtcttcaattgatgcgcgcgcattctatgaagagggcacatataacgagatcccg
cttaactcgatgcgcaaaaccatcgcgcgccgcctcacacaatcgaagcaggaaattccg
cattattaccttaccattgattgcgtactggatgagctactcaaggtccgcaaacatctg
aacgcagaaggcgccgatgcaggcgtcaagctatccgtcaatgacttcattgtccgggcg
gcagcactggcgctcaaaaaagtgccagaggccaatgtgagttttgcagatgatgcgcta
ctccagcatcaccactcggatgtcggcattgcggtggctctggaaggtgggttaatcaca
ccgatcattcgccgtgcagatgaaaagggccttgctgaaatttcggctgaggcgaaagag
ctggcagcccgtgcgagagacaagaaactctcaccggctgaatttgaaggcggaagtttc
tctgtgtcaaacctcggcatgtttggcatcaagaacttcactgcggtgatcaatcctcca
caggcagccattatggctgttggagctggtgagccacggccgatcatcgtggacggtgaa
gtgaaagcggcgactgtgatgacggtgacgctttcctgtgatcacagggcgattgatgga
gcattgggcgcgcagctactcgccgccttcaagtcctacatcgaatatcccccctctatg
ttgctgtga

DBGET integrated database retrieval system