KEGG   Rhodobiaceae bacterium SMS8: RHODOSMS8_02631Help
Entry
RHODOSMS8_02631   CDS       T05596                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rbs  Rhodobiaceae bacterium SMS8
Pathway
rbs00620  Pyruvate metabolism
rbs00680  Methane metabolism
rbs01100  Metabolic pathways
rbs01120  Microbial metabolism in diverse environments
rbs01200  Carbon metabolism
Module
rbs_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rbs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHODOSMS8_02631 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    RHODOSMS8_02631 (ppc)
Enzymes [BR:rbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RHODOSMS8_02631 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: AWZ02147
UniProt: A0A2Z4ULY1
LinkDB All DBs
Position
complement(2653291..2655966)
Genome map
AA seq 891 aa AA seqDB search
MQSSKQTVTQNADVRYLGNLLGDVIRAYGGDSLFERIERVRSVSVDQHRGLVDAEDVDRE
LETLGLDDALHFVRAFMLFSMLANLAEDRQSGVVEGETGLEDVLERLQSLGVGLEQVQDA
LSDMLVMPVLTAHPTEVRRKSVIDHLNHIGELLSLKDRGQTETVAGRSIDHAIRQHIALL
WQTRLLRHQRLTVLDEVEIELDYLRDVFLAVLPAEYSRWERLLGEDCPSFLKIGSWIGGD
RDGNPNVDAACVEHSVSRAAQTVLEHYLDGVHALGAVLSISLEHADVPAEVRALADASGD
DSHARRDEPYRRALSGVYSRLATTYEVLIGRPPPRTSSLDGEPYADADAFRDDLLILERG
LHAPDGQSADDGTLKQLLRAVETFGFHLTTLDFRQNSDVHERVVAELLAGGGVEADYLSL
DEGARVALLRRELANARPLSSAFLAYSAETDSELTLYRAAARVHSRYGKGGISTYVVSKA
DSVSDLLEVYLLLKEVGLYQPGNPPSSGLMVVPLFETIGDLENAQTIMRDWFALPEMRAL
SASRGHQEVMIGYSDSNKDGGYLSSVWCLYDASRKLVPIFEAAETKMQLFHGRGGAVGRG
GGPAFEAIRAQPSGSVQGRIRITEQGEVIAAKYGTQEKAAKNLEAMASATLMATIEPDQL
SSADSERFGGAMADLSADAFSHYRGLVYDTEGFQTFFRQMTPIAEIAGLKIGSRPASRTT
SERIEDLRAIPWVFSWAQSRVMLPGWFGVGTALTRFKDPNLLREMAGEWPFFHTTLTNME
MVLAKSDMEVAKRYVTLVEDKAFAQDIFANIRSEWSRAHDALLEVTGQTRLLENSPSTEN
ALRLRLPYVEPLNMLQVELIKRHRSGESDTRIEQGIQLSISAIATALRNSG
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcttcaaagcagaccgttacccaaaatgccgatgtgcgatatctcgggaatttg
ctgggtgatgtcatccgcgcttatggcggagattcgctgtttgagagaattgagcgggtt
cgttccgtttccgtagaccagcatcgtgggcttgttgacgcagaagatgttgatcgggag
ttagagactcttgggcttgatgacgcgcttcactttgtgcgcgccttcatgcttttttca
atgctggccaatctggcggaggaccggcagagcggcgtcgtagagggcgagacgggtttg
gaggatgtgcttgaacgccttcagagcttaggggttgggctcgagcaagtgcaggacgct
ctttcagatatgctggtgatgcctgttctcacagcacaccccaccgaagttcgtcgcaag
agcgtcattgatcatctcaatcatattggtgagcttctctctctaaaggacagagggcaa
acagaaacagttgcgggccgctcaatcgatcatgcgatccgtcagcacatcgcactgttg
tggcaaacgcggttgctgcgacaccaaagactgaccgtgttggatgaggttgaaattgag
ctcgattaccttcgcgacgtgtttctagcggtcttgccggcggaatattcccgctgggag
cgtttattgggggaggactgccctagttttctgaagatcgggagttggatcggcggggac
cgtgatggcaatccaaatgtagatgcggcttgtgtggagcactcagtgtcgcgcgctgcg
caaactgttttggaacattacctggacggtgtgcatgcgctgggggcagtgttgtcaatt
tcgctggaacatgctgacgttccagcagaggtacgtgcgcttgccgatgcgagcggtgat
gacagccatgcccgtcgcgatgagccctatcgccgggcgctcagtggcgtttactctcgt
ctggcgaccacctatgaggtgctcattggacgcccgcctcccagaacaagctcgcttgac
ggagagccttatgctgacgctgatgcctttcgcgatgatcttttgatcctggagcggggg
ttgcacgcgcccgacggacaatcggctgatgacggaaccttgaagcaattgctgcgcgcg
gttgaaacgtttggcttccatctcaccacactcgatttcagacagaattcggacgtacat
gagcgtgttgttgctgaactgttggcgggcggcggcgtggaagctgactatctttccctg
gatgaaggtgcgcgggtggcattgctgcggagggaacttgcaaatgcgcgccccttgtcc
tcggcttttttggcgtactccgcagaaacagattccgagctcaccctctaccgtgctgcc
gcccgagtgcatagcaggtacggcaaaggagggatctcgacctatgtcgtttccaaagct
gatagcgtgtcagatctcctcgaggtgtatctgcttctcaaggaagtgggactgtaccag
ccaggaaatccgccttcctctggtttgatggtggttccgctttttgaaacgattggcgat
ctggaaaatgcgcaaacgattatgcgcgactggtttgcgctacctgagatgcgggcgctg
tctgcgtcgcgtggccatcaggaagtgatgatcggatattccgactccaataaggatggc
ggctatctttcatccgtatggtgcctgtatgacgcgtcccggaagctggtccccatcttt
gaggcggccgagacaaaaatgcagctcttccatggtcgtggcggtgcggtgggtcgtggc
ggcgggcctgcctttgaggctatccgcgcgcagccttctgggagtgttcagggacgcatt
cgaattaccgagcagggcgaggtcattgctgcaaaatatggcactcaggaaaaagccgcc
aaaaacctagaggcaatggcatcagctactcttatggcgaccatcgagcccgatcagctg
tcatctgcggatagtgaacgttttggcggagcgatggcggatctgtcggcggatgctttc
agccactatcgcgggcttgtttatgacacagaaggtttccaaaccttctttcggcagatg
acgccgatagcggaaatcgcgggcctcaaaattggatcgcgtcccgccagtcgcacgacc
tcagaacggatcgaggacttacgagccattccctgggtgttcagttgggctcagtcccgg
gtcatgttgccaggctggtttggggtgggcaccgcgctcacccgtttcaaggacccgaat
ctcctgagggagatggctggtgaatggcctttcttccatacgacgctgaccaatatggag
atggtgctcgctaaatcagacatggaggttgctaagcgttatgtgaccctcgtggaggac
aaggcgttcgcgcaggatattttcgcaaatattcgatcggagtggtcgcgagcccatgat
gcgttgttggaggtgacgggacagactcgtcttctggaaaatagtccctctacagaaaac
gctctccggttacgtctgccttatgttgaaccgcttaacatgctccaggttgaactgatt
aaacggcaccggtcgggcgaaagcgatacacgtattgagcaagggatacagctttccatc
agtgcgattgccaccgctctcagaaatagcggttag

DBGET integrated database retrieval system