KEGG   Rhodobiaceae bacterium SMS8: RHODOSMS8_03066Help
Entry
RHODOSMS8_03066   CDS       T05596                                 

Gene name
qbdA
Definition
(GenBank) quinohemoprotein alcohol dehydrogenase ADH IIB
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
rbs  Rhodobiaceae bacterium SMS8
Brite
KEGG Orthology (KO) [BR:rbs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RHODOSMS8_03066 (qbdA)
Enzymes [BR:rbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     RHODOSMS8_03066 (qbdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AWZ02576
UniProt: A0A2Z4UNS6
LinkDB All DBs
Position
complement(3080546..3082801)
Genome map
AA seq 751 aa AA seqDB search
MSDFLREKWPVLVNSAAGVVIAAVVVMQFAGGGDDADTTSLPDAVSGGEVAEAPAEETPA
APAEAVARVVVDVDGARIVNADSEPGNWMSHGRTYSEQRYSPLSQINDQNASELGLAWSF
NTGTVRGLEATPIVVDEMLFTTGNWGVVHALNAKTGEELWEFDPEVPGEWARYGCCDIVN
RGVAVWKGRVYVASFDGRLFALNAEDGSVHWEVNTIPGPPYTITGAPRIVNGKVIIGNGG
AELGVRGYITAYDAETGEQAWRFYTVPGNPADGFEHPELEVAVETWKGGRWWEIGGGGTA
WDSMAYDAELDTLYVGVGNGSPWTREIRSPGGGDNLYLSTILALDPNTGRLKWHYQTTPS
DNWDYTATQHIVLAELEIDGKERKVLMQAPKNGFFYVIDRETGELLSADPYITVTWASHV
DMETGRPVENPAVGYNIDPQFVFPSANGGHNWHPMAFNPDTGLVYIPTQEIGGIYTLANQ
WKEGKEFKVRENWWNTGLDWADYVDVINGLLAEGGELPIDHGYLKAFDPLTGETRWAIEM
PSILNGGVLTTAGNLVLQGTADGRFVAYRADTGTELWRANVQTGIVAAPMTYEIDGEQYV
AVMAGWGGTALPSGDARTSAAAKYGNDGRLLVFKVNGTEELPELALLDQTIPEQPEVTAT
PEQLRNGEVQFMSVCGLCHGALAVSGGVLPDLRRMSPTTREHFDAIVREGMLEENGMPNF
GDLLNEQDVQDIYSYIIKRATEDRALQLPTE
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactttttgcgggagaagtggccggttctggtgaactcggctgctggggtggtt
attgccgctgttgtggtgatgcagtttgcgggcggcggcgatgacgccgatacaacaagc
ctgccggatgcggtgtcgggaggcgaggttgccgaagcaccagctgaagaaacaccggcg
gcgccagcggaagccgtagcgcgggtggtcgtagacgtagatggggcacggatcgttaat
gctgatagtgagcctggcaactggatgagccacgggcggacctattcagagcagcgctat
tcacctcttagtcagatcaatgatcaaaatgcgagcgagcttggtcttgcctggtccttc
aacacgggcacggttcgtggtctggaggcaacgcccatcgttgttgacgagatgctgttc
accacaggcaattggggcgtggttcatgcgctcaacgcaaagaccggtgaagagctttgg
gagttcgatccagaagtgcccggcgagtgggcgcggtatggctgctgtgacattgtcaat
cgcggcgtcgccgtctggaagggccgtgtctatgtagcgagttttgacggacgtctcttt
gcactcaacgctgaagatggttccgtgcattgggaggtgaatacgatcccgggtcccccc
tacacgattaccggtgctccacggatcgtgaacggaaaagtcatcatcgggaatggcggc
gctgagcttggcgtgcgtggatacatcaccgcttatgatgctgagaccggcgaacaggcc
tggcgcttctacaccgtaccgggtaacccggccgatggatttgaacaccctgaattggaa
gtggctgttgagacctggaaaggcggtcgctggtgggaaattggtggtggtggaaccgcg
tgggactccatggcctatgatgctgagctcgacacactttatgtgggcgttgggaatggg
tcaccgtggacacgggaaatccggtcacctggtggtggggacaatctctatctctccacc
attcttgcacttgatcccaatacgggtcggttgaagtggcactatcaaacaacgccgagc
gacaattgggactacacagcgacgcagcacattgttcttgctgagcttgagattgacggg
aaagagcgcaaggtgctgatgcaggcaccgaagaacggcttcttctatgtgattgatcgg
gagacgggagaacttctctccgctgatccctacatcacggttacctgggcgagtcatgtt
gatatggaaaccgggcgtccggttgagaacccagcggtcggatacaatatagatccgcag
tttgtgttcccgtcagccaatggcggtcacaactggcacccgatggcgtttaatccggat
acgggccttgtctacattccaacgcaggaaattggcggcatctacacgctcgccaatcaa
tggaaagagggcaaagaattcaaagtccgtgagaactggtggaacacgggccttgattgg
gctgactatgtcgacgtgatcaatggcctgcttgcagagggcggtgaacttccgatcgat
catggatatctcaaagcttttgacccgctgaccggcgagacgcgctgggcgattgagatg
ccttcgatcctgaatggtggcgtcttgacgacggctggtaatctagtgctgcagggtacg
gccgatggccgttttgttgcctaccgtgccgacacaggcacagagctttggcgggcaaat
gtccagacgggtattgttgcagctcccatgacttatgaaattgatggcgagcagtatgtc
gccgtcatggcgggttggggcggcacggctcttccatctggcgatgcgcgcacatctgcg
gcggccaagtatggcaatgatgggcgtcttctggttttcaaagtgaatggtacagaagag
cttcctgaacttgctctgcttgatcagaccatccctgagcaaccggaagtaacggcaacg
cctgagcaactccgcaatggcgaagttcagttcatgtctgtctgtggtctttgtcatggc
gccctggcggtcagtggcggcgtgctgcccgaccttcgtcgcatgagcccaacgacgcgt
gaacatttcgacgcgatcgtgagagaaggcatgctcgaagaaaatggcatgccgaacttt
ggtgatctgttgaatgagcaagatgtgcaggatatttactcctacatcatcaagcgggcg
acggaagacagagcgcttcagttaccaacagaataa

DBGET integrated database retrieval system