KEGG   Rugosibacter aromaticivorans: PG1C_00060Help
Entry
PG1C_00060        CDS       T03689                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00970  Aminoacyl-tRNA biosynthesis
rbu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PG1C_00060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rbu03029]
    PG1C_00060
Enzymes [BR:rbu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PG1C_00060
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PG1C_00060
Mitochondrial biogenesis [BR:rbu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PG1C_00060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AJP47261
UniProt: A0A0C5JIW7
LinkDB All DBs
Position
complement(13975..15468)
Genome map
AA seq 497 aa AA seqDB search
MINASLKELSAALAQRKISAVELATLFLDRMERLNPTLNAFITTDRDKTLAQARCADEIR
KVGAGDTAASLSDTPLNGIPLAHKDIFCTQGWRTTCGSKMLANFVSPYDAHVVERFAAAG
MVTLGKLNMDEFAMGSSNETSFFGPVKNPWDVSRVPGGSSGGSAAAIAARLAPAATGTDT
GGSIRQPAALCGLTGLKPTYGVVSRYGMIAFASSLDQAGPMAKSAEDCALMLTAMAGFDT
RDSTSLERPAEDYSRHLNQPLTGLKIGLPKEFFGDGMDTDVRAAVEAALAEYRKLGATTV
EVSLPHSELSVPAYYVIAPAEASSNLSRFDGVRYGYRAPDYGDLADMYSKTRAQGFGAEV
KRRILIGTYVLSHGYYDAYYLKAQKIRRLIAADFTEAFTQCDVIMGPTSPSVAFAFGAKN
ADPVQMYLSDIYTISTNLAGLPGMSLPCGFGNAQLPNPMPVGLQIIGRWFDEARMLNVAH
QYQQVTDWHMRMPEGMA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacgccagcctgaaagaattatctgccgcactggcgcagaggaagatttctgcg
gttgaactcgccacgctttttcttgaccgcatggagcgcctgaacccgacgctgaatgcg
tttatcaccaccgaccgtgacaagacgctggcccaggcacggtgcgcagatgagatacga
aaagtcggcgctggtgacacggcggcatcgttgtccgatacacccttgaacggcattccg
ctggcgcacaaagacattttttgcacgcagggctggcgcaccacctgcggctcgaagatg
ctggccaatttcgtctcgccctatgacgcgcatgtggtcgagcgctttgccgctgctggc
atggtcacgctgggcaagctcaacatggacgagttcgccatgggctcgtcgaacgaaaca
tcttttttcggcccggtaaaaaacccgtgggatgtctcccgcgtgccgggcggctcatcg
ggcggttcggctgctgccattgcagcgcggctggcgccagcggccacgggtaccgacacc
ggtggctcgattcgacagccggcggccttgtgcggcctgaccggcctcaaacccacctat
ggtgtggtttcgcgctatggcatgatcgcttttgcttccagcctcgatcaagccggacca
atggccaagagcgccgaagactgcgcgctgatgctgaccgcaatggccgggttcgacacc
cgcgactcaacgtcgctggaacgccccgctgaggattacagccgccatctgaatcaaccg
ctgaccggtctgaaaattggcttgccaaaagagttttttggcgatggcatggataccgat
gtgcgtgcagcggtcgaagcggcactggctgaataccgcaaacttggcgcaacgacagtt
gaagtcagcctgccccattcggaattgtccgtaccggcttattacgtgatcgcccccgcc
gaggccagctcgaatctctcccgcttcgacggcgtacgttacggctatcgcgcaccagac
tacggcgatctggccgatatgtattcaaaaacgcgggcgcagggtttcggtgccgaagtg
aaacgccgcatcctgatcggcacctatgtgctgtcgcatggctattacgatgcttattac
ctcaaagcgcaaaagatccgccgtctcatcgccgccgactttaccgaggcattcacgcag
tgcgatgtcatcatgggcccaacatcaccctcggttgctttcgccttcggcgcgaagaat
gccgatccggtgcaaatgtatctctccgatatttacaccatctcgaccaatctcgccggg
ttgccgggcatgtcgctgccgtgcgggtttggcaacgctcagttgccaaatccgatgccg
gtcggcctgcaaattatcggccgctggtttgacgaggccagaatgctcaatgtcgcccat
cagtatcagcaagtcactgactggcacatgcggatgccggagggtatggcatga

DBGET integrated database retrieval system