KEGG   Rugosibacter aromaticivorans: PG1C_02590Help
Entry
PG1C_02590        CDS       T03689                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00473  D-Alanine metabolism
rbu00550  Peptidoglycan biosynthesis
rbu01100  Metabolic pathways
rbu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PG1C_02590
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PG1C_02590
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PG1C_02590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rbu01011]
    PG1C_02590
Enzymes [BR:rbu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PG1C_02590
Peptidoglycan biosynthesis and degradation proteins [BR:rbu01011]
 Precursor biosynthesis
  Amino acid ligase
   PG1C_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATPgrasp_ST ATPgrasp_YheCD ATP-grasp_3 ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AJP47648
UniProt: A0A0C5J7I1
LinkDB All DBs
Position
509486..510394
Genome map
AA seq 302 aa AA seqDB search
MNFGKVAVMMGGKSAEREVSLKSGAAVLSALRAAGIDAAPFDPQDKPLEALHGENFSRVF
IALHGRGGEDGSMQGALNLLNIPYTGSGVLASALAMDKWRCKLVWAAAGLPVPEYGIVTP
TSNFAEIEARLGLPLFVKPANEGSSIGISKVKESGGLRAAFKLAAQYDSCVIAERFLAGG
EFTVGIIGDQALPVIRIVPQTEFYDFAAKYSRDDTTYHIPSGLGEAREAEIRAMALRAFA
ALGGRSWGRIDVLLDAEGRAWCLEANTSPGMTDHSLVPMAAKAAGISFGDLVVKLLVEAR
CD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaattttggcaaagtagccgtgatgatgggtggcaagtcggcagagcgcgaagtgtcg
ttaaaaagcggcgcggcggtgctgtcggcactgcgtgctgcgggaattgatgccgccccg
tttgacccgcaggacaaacccctcgaagcgttgcatggcgaaaatttcagccgcgtgttc
attgcgctgcatgggcggggtggggaagacggcagtatgcaaggcgccctgaatctgctg
aatattccttataccggcagtggcgtgctggcttctgccctggcgatggataagtggcgg
tgcaaattggtctgggccgctgctggcctgcccgtgccggaatacgggattgtgacgccg
accagtaactttgccgaaattgaagcgcggctgggtttacccctgtttgtgaagcccgcc
aatgaaggttccagcatcggcattagcaaggtaaaagagtctggcggcctgcgtgccgcg
tttaagctggccgcacaatatgattcgtgcgtcattgcagagcggttcttggccggcggt
gaatttactgttgggattatcggggaccaggcattgccggtgattcgcattgttccgcaa
actgagttttatgattttgcagccaagtattcgcgtgatgacacgacataccacatcccc
agcggtttaggcgaggcacgggaggcagaaattcgtgccatggcgttacgcgcttttgca
gcactgggtggtcgcagttgggggcgcattgatgtgctgctggatgctgaaggccgcgcc
tggtgtctggaggccaacacctcgccgggcatgaccgatcactcgctggtgccgatggcg
gcaaaggctgcgggaatttcgttcggcgatctggtcgtgaagttactggtggaggcacgc
tgtgattaa

DBGET integrated database retrieval system