KEGG   Rugosibacter aromaticivorans: PG1C_04345Help
Entry
PG1C_04345        CDS       T03689                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PG1C_04345
Enzymes [BR:rbu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PG1C_04345
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PG1C_04345
    1.1.1.-  
     PG1C_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C TrkA_N Sacchrp_dh_NADP ADH_N_2 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AJP47908
UniProt: A0A0C5J843
LinkDB All DBs
Position
870626..871645
Genome map
AA seq 339 aa AA seqDB search
MLAAVLKGPRDLELQEVTQPKPGPGEVLLEVGFTGICGTDLHEFLRPTFSNPPVVLGHET
SGTIVELGAEVHSRKVGERVTVIPMDFCGQCYYCHRAMYHLCDRPGWVGFTRSGAFARYV
AVPARLAIPLPENVPLEIGALTEHFTVAFHAMHRADLRIGERVLVLGAGPVGLAVLQCAS
ASGAGSIVAVEPSPLRAQRATDLGATSVVDPAAAESLKDLTQGVGFDVVFDAAGTDGALQ
LGFNHLRKGGRYMSMCPWEKSPAIDMNRALLSEHDVRFVFGYDMFNDFRGVLDLVSRGVL
EAGRQITSRIALKNILADGMLPLVESRDKQIKVMVDLGQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgctagccgctgtattaaaaggaccccgtgatctggagttgcaagaggtaacacagccc
aagccagggcctggcgaggtattgcttgaagtcgggtttaccggcatttgcggaaccgat
ctgcacgaatttttaaggccgacgttttccaacccgccggtggtgcttgggcacgaaaca
tccggcacgattgttgaactgggcgcagaggtgcattcgcgtaaagtgggcgagcgggtg
acagtgatcccgatggatttttgcgggcaatgctattactgccatcgtgccatgtatcac
ctgtgcgatcggcccggctgggttggtttcacgcgcagtggtgcattcgctcgctatgtt
gccgtgcccgcgcgcctggcgattcccttgcccgaaaatgtgcccctggaaatcggtgcc
ttgactgagcatttcacggtggcgtttcatgccatgcatcgcgcagatttacgcattggc
gaacgggtgctggtgctcggcgcagggccggttggtctggctgtgctgcaatgcgcttcg
gcttcgggcgcgggttcgattgtggcggtagagccaagtcccttgcgtgcgcaacgtgcg
acagatctcggggcgacaagcgttgtggatcctgccgcagccgaaagcctgaaagatctg
acacagggcgtgggattcgatgtcgtgttcgatgcagcaggcacggatggcgcattgcaa
ctggggtttaaccatctacgcaaaggcggacgctatatgtcgatgtgtccctgggagaag
tcccccgcaatcgatatgaaccgcgcattgcttagcgagcacgatgtgcggtttgtgttc
ggctacgatatgttcaacgattttcgcggtgtgctcgatctggtctcgcgtggggtgcta
gaagcgggacgtcagattacctcccgcattgccctgaaaaatattctcgctgacggtatg
cttcccttggtggaaagccgcgataagcagatcaaagtgatggttgatttagggcagtaa

DBGET integrated database retrieval system