KEGG   Rugosibacter aromaticivorans: PG1C_06125Help
Entry
PG1C_06125        CDS       T03689                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00620  Pyruvate metabolism
rbu00680  Methane metabolism
rbu01100  Metabolic pathways
rbu01120  Microbial metabolism in diverse environments
rbu01200  Carbon metabolism
Module
rbu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PG1C_06125
  09102 Energy metabolism
   00680 Methane metabolism
    PG1C_06125
Enzymes [BR:rbu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PG1C_06125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AJP49458
UniProt: A0A0C5JC80
LinkDB All DBs
Position
complement(1255744..1258509)
Genome map
AA seq 921 aa AA seqDB search
MITADHSTEDKEAPLREDIRFLGRLLGDTLRQQEGNDAFDTVEHIRQLAIRFHRHDDLAA
RDQLEALLAALPNDHTTQVARAFSYFSHLANIAEDQHHLRRARAHALAGAKPREGSLEMA
IARAQEAGIDAHGFSDFFAQAKVSPVLTAHPTEVQRKSILDCQWEIARLLDARDRNELTP
DEMQEDEEAIRRAVLTLWQTRMLRRVKLSVADEIANALTFYDTTFLRELPQLYNRLEDHL
ALIVPHWTKDELKPFLHPGSWIGGDRDGNPFVTADVLLAAVRAQSRKALSHQLEQLHRLG
AELSLTASLVDISDALKALVARSPDHSPHRDDEPYRRAIAGMYARLAATAQQLDELEAPR
HPVGTAEPYANAAEFAADLDVLHGSLINHKSTLLARGRLRHLRRSIAIFGFHLAPLDLRQ
NSEVHARTVAELLAIACPGTDYLALDEAARIKLLLDELATPRPLTAPSVTYSTETQSELA
IFHTAGQIHQRYGRASIENVIISKASSVSDMLEVAVLLKEAGLLRPLDHALDVNIVPLFE
TISDLENAAEVMDQLLSLPLYKQLLDSRGSWQEIMLGYSDSNKDGGFLTSGWALYRSEIA
LTAIFARHGVRLRLFHGRGGSVGRGGGPSYQAILAQPQGAVQGQIRITEQGEVIASKYAN
PELGHRNLEILAAATLEATLLPRVFDNPPPEFLAAMETLSASAFSAYRSLVYDTPGFEQY
FWESTVIAEIASLNIGSRPASRKHSTAIEDLRAIPWVFSWAQCRLMLPGWFGFGTAVAKW
KATRGEVGMQLLCRMNREWGFFRTLLSNMDMVLAKSDIAIAERYSELVSDEALRRAIFPR
LKAERQAAIDALLEITQTNELLDSNPPLKRSIRNRFPYIDPLNHLQVELLRRFRAGTTDE
KVQRGIHLSINGIAAGLRNSG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgccgaccattctaccgaagacaaagaggcacccttacgcgaagatatccgc
tttcttggccggctcctgggcgataccctgcgtcaacaggaaggcaatgacgccttcgat
acagttgagcacattcgccagctagcgatacgttttcaccggcatgacgacctggccgca
cgcgatcagctagaagccctgctcgccgcattgcctaacgaccacacgacccaagtcgcc
cgggcctttagctacttttcgcatctcgccaatattgcagaagatcagcaccacctgcgc
cgtgcccgcgctcatgcattggccggcgcaaaaccccgcgaaggcagcctggagatggcg
attgcccgcgcacaagaagccggcattgatgcccacggtttttccgattttttcgcgcag
gcaaaagtttccccggtgctcactgcacacccgacggaagttcagcgtaaaagcattctc
gactgccaatgggaaatcgcccgcttgcttgatgcgcgcgaccgcaacgagctcaccccc
gatgaaatgcaagaagacgaagaagccattcgccgtgctgtgctgacgctatggcagacg
cgcatgctgcgccgggtcaagctttcagtcgcggatgaaattgccaatgcgctgacgttt
tacgacaccacattcttgcgcgagctacctcagctatataaccggctggaagaccatctt
gcgctcatcgtgccccactggacaaaagatgaactgaaaccatttttacaccccggctcg
tggatcggtggcgaccgcgatggcaaccccttcgttaccgcagacgtattactggcggct
gtgcgcgcgcaaagccgcaaagccctcagccaccaactagaacaactccatcggctgggc
gctgagctgtcgctcaccgcctctctggttgatatttccgatgccttaaaagcgctggta
gcccgctcacccgatcacagtccgcatcgcgatgacgagccgtaccgccgcgccattgcc
ggcatgtatgcgcgcctggccgccaccgcacagcaactagatgaactcgaagcaccacgc
catcctgtgggtaccgctgagccttatgccaatgccgctgagttcgctgcagatctggat
gttctgcatggctcgttaataaaccacaagtcaaccctgctcgcccgtggtcgtttgcgc
catcttcgccgtagcattgccatttttggctttcacttggcgccccttgatctgcgccaa
aattccgaggtacacgcccgcaccgtagcggagctacttgctatcgcctgccctggcacc
gactatctcgcgctcgatgaagccgctcgcatcaaactattgcttgacgaactcgccacg
ccccggccgcttaccgcgccttctgtgacttactcgaccgagacacaaagcgaactggcc
atctttcatactgccggccagattcatcagcgctatggtcgagcgtcgatcgagaacgtc
attatttccaaggccagcagcgtatccgatatgcttgaagtggctgtgctacttaaagaa
gccgggttgttacggccacttgaccatgcgctggatgtgaatatcgtgccgctgttcgaa
acgattagcgaccttgaaaacgcagcggaagtgatggatcaattattatccttgccactt
tacaaacagctgctggacagccgtggaagctggcaggaaatcatgctgggttattcggac
agtaacaaggatggcggctttttgacctctggctgggcgttatatcgcagcgagattgcc
ctcaccgctattttcgcccgccacggtgttcgcctgcgcctgtttcacgggcggggtggc
tcggtaggccgtggcggcgggcccagctatcaggcgattctcgcccagccgcaaggcgca
gtacaaggacaaatacgcattaccgagcaaggcgaagtcattgcctcaaaatacgccaac
ccggaactcggtcaccgtaatctggaaattcttgctgccgccacgcttgaagccacgttg
ctgccacgggtgtttgataacccgccgccagaatttcttgccgccatggaaaccctctca
gccagcgcctttagcgcctatcggtcattggtttacgacacacccggctttgagcagtat
ttttgggagtccactgtcattgccgaaattgcttctcttaacattggcagccgtcccgcc
tcacgcaagcacagcaccgcgatcgaagatttacgggcgattccgtgggtcttttcctgg
gcgcaatgtcgtctcatgctgccgggctggtttggcttcggtactgccgtggcaaaatgg
aaagccacacgaggcgaagtcggcatgcaactgctttgccgcatgaatcgggaatgggga
ttctttcgcacgctgctttccaacatggatatggttctggcaaaaagcgatattgccatt
gcagagcgctattcggaattggttagcgacgaggcattgcgccgcgccattttcccgcgc
ctgaaagccgagaggcaggcggccattgatgcgttacttgaaattacgcagacaaacgaa
ttgcttgacagcaacccgccattaaaacgatctattcgcaaccgctttccatacatcgac
ccactcaaccatctgcaagtcgagctgctgcgccgttttcgcgccggtactaccgatgaa
aaagtgcaacgcggcatccacctcagcatcaacggcatcgctgccggattacgcaacagc
ggctaa

DBGET integrated database retrieval system