KEGG   Rugosibacter aromaticivorans: PG1C_11575
Entry
PG1C_11575        CDS       T03689                                 

Definition
(GenBank) carbazole dioxygenase
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00621  Dioxin degradation
rbu01100  Metabolic pathways
rbu01120  Microbial metabolism in diverse environments
rbu01220  Degradation of aromatic compounds
Module
rbu_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PG1C_11575
Enzymes [BR:rbu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     PG1C_11575
SSDB
Motif
Pfam: Aromatic_hydrox Rieske VanA_C
Other DBs
NCBI-ProteinID: AJP48893
UniProt: A0A0C5JAR2
LinkDB
Position
2368593..2369750
AA seq 385 aa
MANVKEEILKKVKGWAGYVDAKLGFRNHWYPVAFGKDIDEGQPQKIKLLGEDLLVSRVNG
KLFCIKDRCLHRGVSFSVKIESYTPETITCWYHGWTYRWEDGLLSDIITNPESIQIGKQR
VKVYPVQEAKGCVFIFLGDIDPPPLVTDVPPTFLDDDMVICGQNKIVHSNWRLAAENGFD
PAHIFIHKDSVLIKGNDLALPLGFAPKGDAKMRTRIVEDDEEQGAKGVFDLLAEASVPVF
EGKIDGKVVRTGNFGHNRVANNISIWLPGVLRVQPFPDPATTQFEWYVPVDENSHYYFQT
IGKRCASPAEEQVYMEEFNTKWRAMALDGFNNDDVWAREAMVGFYADDEGWLKEILFEAD
SAIVDWRKLCSKHNRGVQTQEHIKA
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggctaatgtcaaagaagaaattttgaaaaaagtgaaaggctgggcaggttatgttgat
gccaaattaggctttcgcaatcactggtatccggtcgccttcggtaaagatattgacgaa
ggtcagccacaaaaaatcaagctgctgggcgaagatttactggtcagtcgtgtgaatggc
aaacttttttgcatcaaggatcgttgcttgcaccgaggcgtgtctttctcggtaaaaatt
gaatcctatacccctgaaaccatcacctgctggtaccacggttggacctaccgctgggaa
gacggattgctgagtgacatcattaccaatccggaaagcattcaaattggcaagcaacgg
gtaaaagtctaccccgtacaagaagccaaagggtgtgtcttcattttcctcggcgatatt
gatccgccgccactggtgacagatgtgccgccaacatttcttgatgacgacatggtgatt
tgtggccagaataaaattgtccattcgaattggcgactcgccgccgaaaacgggtttgat
ccagcgcatatctttatccataaagactctgttctcatcaaaggcaacgatctggcgcta
ccccttggctttgcacccaaaggggatgccaaaatgcgcacccgcattgttgaagacgat
gaagaacaaggtgccaaaggcgtgtttgacttgttagcggaagcgtctgtcccggtattc
gaaggaaagatcgacggcaaagtcgtccgtacggggaactttggccataaccgcgtcgcc
aacaatatttccatctggctgccgggcgtattacgtgtacaaccctttccggatcccgcc
accacccagtttgaatggtatgttcccgtggatgaaaacagtcactattactttcaaacc
atcggcaaacgctgcgcctcgcccgcagaagaacaggtctacatggaggaattcaacacc
aagtggcgcgccatggcgctggatggttttaacaatgatgatgtctgggcaagagaagcg
atggtgggtttctatgccgacgatgagggctggttaaaagaaattcttttcgaagccgat
agcgcgattgtcgactggcgcaaactttgctcgaagcacaaccgcggcgtgcaaacccag
gaacatatcaaggcttga

DBGET integrated database retrieval system