KEGG   Rugosibacter aromaticivorans: PG1C_11590Help
Entry
PG1C_11590        CDS       T03689                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00621  Dioxin degradation
rbu01100  Metabolic pathways
rbu01120  Microbial metabolism in diverse environments
rbu01220  Degradation of aromatic compounds
Module
rbu_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PG1C_11590
Enzymes [BR:rbu01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     PG1C_11590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Abhydrolase_5 Esterase FSH1 Abhydrolase_4
Motif
Other DBs
NCBI-ProteinID: AJP48895
UniProt: A0A0C5JAD3
LinkDB All DBs
Position
2371729..2372559
Genome map
AA seq 276 aa AA seqDB search
MHLNEADYQKKYINVNGVNTCYIESGAGEPLILIHGGGAGANSYGNWFACMPLFAKHFRV
IAIDMLGFGSTDAPDPTTCDYSQKARYDHVAGFIRALGLAKASLVGNSMGGATAMGVAIE
HPALVDKLILMGSAGLNGEITPALLPVVNYDFTREGMVKLIKTLANDKFVITQEMIDYRW
NNSVKPETRAAYGNTMAWIKKQGGLFYPEEYIARVKHKTLVVNGKNDLVVPLTHAYRFLE
LIEHSWGYIVPHCGHWAMIEHPEDFSAAVTSFIKSH
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcaatgaagcagactatcaaaaaaagtatattaacgtgaatggcgtcaacacc
tgctatatcgaatcaggtgcaggtgagccgctgatattgatccatggtggcggtgccggt
gccaacagctatggcaactggtttgcctgcatgcccctgtttgccaaacactttcgcgta
atcgccatcgacatgctgggttttggcagcaccgatgcccccgacccaacaacctgcgat
tactcgcaaaaagcacgttatgaccacgttgccggatttatccgtgcgcttggcttagcc
aaagcgtcactggtgggaaattccatgggcggtgccaccgccatgggcgttgccattgag
catccggcacttgtcgacaaactcatcctgatgggcagcgccggtctgaatggcgaaatc
acccccgcgcttttgcctgttgtcaattacgacttcacccgggaaggaatggttaagctg
ataaaaacgctggccaacgacaagtttgtcatcacgcaggaaatgattgactatcgctgg
aacaactctgtcaagccagaaaccagggcggcttacggcaacaccatggcgtggattaaa
aaacagggcgggttgttttatcctgaagagtatattgcgcgcgtcaagcacaaaacgctt
gtcgtcaatggtaaaaatgacctggtcgtcccgctgacgcatgcttaccgtttcctggaa
ttgattgagcactcgtggggctatatcgttcctcattgcggtcactgggcgatgattgaa
caccccgaagatttttctgctgcggtcacttcgtttatcaagtcacattaa

DBGET integrated database retrieval system