KEGG   Rugosibacter aromaticivorans: PG1C_12770Help
Entry
PG1C_12770        CDS       T03689                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rbu  Rugosibacter aromaticivorans
Pathway
rbu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rbu01100  Metabolic pathways
rbu01110  Biosynthesis of secondary metabolites
rbu01130  Biosynthesis of antibiotics
rbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rbu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PG1C_12770
Enzymes [BR:rbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PG1C_12770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA_22 AAA_16 AAA Ploopntkinase3 AAA_17 APS_kinase AAA_28 AAA_5 AAA_24 RNA_helicase SRP54 Thymidylate_kin NB-ARC Zeta_toxin Cytidylate_kin AAA_30 RuvB_N TsaE ADK ABC_tran Mg_chelatase Viral_helicase1 KTI12
Motif
Other DBs
NCBI-ProteinID: AJP49068
UniProt: A0A0C5JB86
LinkDB All DBs
Position
complement(2615654..2616181)
Genome map
AA seq 175 aa AA seqDB search
MNSSDNIYLVGMPGAGKTTVGRQLARRLHRQFIDADHEIEVRAGVKIPVIFETEGEAGFR
EQETRVIADLAKQSNLIVATGGGAVLRPENCDAIKKSGLVVYLRVAPRILFDRTHHDANR
PLLQVANPMMRIEELFTQRDPIYQDVADLVMTSGGGSVFHLVTQVERELRKRCAA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgaattccagcgataacatttatttagtgggcatgcctggcgccggtaaaacaacggtg
ggcaggcagttggcgcgccgtctgcaccgtcagtttattgatgctgaccatgaaatagaa
gtacgcgctggcgtcaaaattccggtgattttcgagaccgaaggcgaagcgggctttcgt
gaacaagagacccgtgtgatcgctgatttagctaagcaatccaacctgattgttgccact
ggcggcggtgctgttctgaggccggaaaattgtgatgcaataaaaaaaagcgggctggtt
gtttatcttcgggtagcgccgcgcattctgtttgatcggacgcaccatgatgctaaccgc
ccattgcttcaggtagcgaatcccatgatgagaattgaagagctttttacacagcgcgac
cctatttaccaagatgtagctgatttggttatgaccagtggtggtggtagcgtttttcat
ctggtaacgcaagttgaacgagagctgcgtaaacgatgcgccgcttga

DBGET integrated database retrieval system