KEGG   Rhodococcus biphenylivorans: CEJ39_03120Help
Entry
CEJ39_03120       CDS       T05830                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rby  Rhodococcus biphenylivorans
Brite
KEGG Orthology (KO) [BR:rby00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rby01001]
    CEJ39_03120
Enzymes [BR:rby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CEJ39_03120
Protein kinases [BR:rby01001]
 Serine/threonine kinases: Other
  Bacterial family
   CEJ39_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: AWZ23301
UniProt: A0A2Z4VDA6
LinkDB All DBs
Position
complement(648001..649569)
Genome map
AA seq 522 aa AA seqDB search
MALSSGAMIADRYRLQRLIATGGMGQVWEGLDTRLDRRVAVKVLKAELSGDEDFLARFRF
EARTTAQLNHPGIAGVFDYGETTDAEGQSIAYLVMELVHGEPLNAVLSRLGRLSLPHALD
MLEQTGRALQAAHNAGVVHRDVKPGNILITPTGQVKITDFGIAKAVDASPVTRTGMVMGT
AQYIAPEQALGQEATSASDVYSLAVVGYEVLSGRRPFLGDSVVTVAMKHVQETPAPLPTD
LPPEVRELIEIAMSKDPAYRYSNGGEFANAVAAVRSGRPVPPPGNVPPVTSANRVLPPGV
PGTTAHTSSTRALHPTQYDQTAYSSVPRSAQPPTAGRPPVAGPPTTGVPADDDGRRSPSP
TALAWAAGAAVVLALVTLGIVLLGGDDEETPRAPSPTTQLTTTRATTTTTRPPLTTTTTF
VPLPPPVETETFTPPPTTTTTQPPTTTVEPTTEPTTTQPPTTTTAPTTTTTTTTTAEDTG
GGDGGTGGAEGNGDDETDPEAAGGGDDNSSETSNGTNNQGTS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggctctgagcagcggcgccatgatcgccgaccgttaccgtctccagcgactcatcgcg
accggcggaatgggtcaggtgtgggaaggactcgacacccggctcgaccggcgggtcgcg
gtgaaggtcctcaaggccgagttgtccggcgacgaggacttcctcgcccggttccgtttc
gaggcccgcaccaccgcccagctcaaccatcccggcatcgccggggtgttcgactacggc
gagaccaccgacgccgagggccagtccatcgcctatctcgtgatggaactcgtacacggc
gaaccgctcaacgccgtcctgtcgcggctcggacgcctgtcgctgccgcacgcgctcgac
atgctcgagcagaccggacgcgccctgcaggcggcccacaacgccggcgtggtgcaccgc
gacgtcaagcccggcaacatcctcatcaccccgacgggccaggtgaagatcaccgacttc
ggtatcgcgaaggcagtcgacgcctccccggtcacccgcaccggcatggtgatgggcacc
gcacagtacatcgctcccgagcaggcactgggtcaggaggcgacgtccgcgagcgacgtg
tactcgctggccgtcgtcggctacgaggtgctgtcgggacgccgtccgttcctcggcgac
agcgtcgtaaccgtcgcgatgaagcatgtccaggagaccccggcgccgctgccgacggat
cttccgcccgaggtgcgcgaactcatcgagatcgcgatgtcgaaggacccggcctaccgc
tattcgaacggtggcgaattcgccaacgccgtcgctgcggtgcggtccggacggcccgtg
cccccgcccggcaacgtgccgccggtgaccagcgccaaccgcgtgcttccgcccggcgtg
cccggcacgacggcccacacttcttcgacccgtgccctgcacccgacgcagtacgaccag
acggcctattcgtcggttccccgctcggctcagccgccgaccgccggccgtccgccggtg
gcaggtccgccgactacgggagtgcccgccgacgatgacggacgacggtccccgagtccc
acagcgctggcctgggccgcaggtgcggcagtggtgctcgccctcgtgacgctgggaatc
gtgctgttgggtggcgacgacgaggagaccccgcgcgctccgtctccgacgacgcaactc
accacgacccgcgcgaccaccacgacgacccgtccgccgctgaccaccacgacgacgttc
gtgccgctgccgccgcccgtcgagacggagaccttcacgcctcctccgaccacgacgacg
acgcagccgccgacgaccacggtggagccgacgaccgagccgaccacgacgcaaccgccc
accaccacgaccgccccgaccacgacgacgaccaccaccaccacagcggaggacacgggt
ggcggcgacggcggcacgggcggcgcggagggtaacggcgacgacgagaccgaccccgag
gccgccggtggaggggacgacaattcatccgaaaccagcaacggtacgaacaaccaagga
acgtcatga

DBGET integrated database retrieval system