KEGG   Rhodococcus biphenylivorans: CEJ39_05415Help
Entry
CEJ39_05415       CDS       T05830                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rby  Rhodococcus biphenylivorans
Pathway
rby00250  Alanine, aspartate and glutamate metabolism
rby00410  beta-Alanine metabolism
rby00640  Propanoate metabolism
rby00650  Butanoate metabolism
rby01100  Metabolic pathways
rby01120  Microbial metabolism in diverse environments
Module
rby_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rby00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CEJ39_05415
   00650 Butanoate metabolism
    CEJ39_05415
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CEJ39_05415
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CEJ39_05415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rby01007]
    CEJ39_05415
Enzymes [BR:rby01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CEJ39_05415
Amino acid related enzymes [BR:rby01007]
 Aminotransferase (transaminase)
  Class III
   CEJ39_05415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AWZ23684
UniProt: A0A2Z4VES8
LinkDB All DBs
Position
1140672..1141913
Genome map
AA seq 413 aa AA seqDB search
MTRLSPRLLQATPVTVDHAEGCYIHGTDGRRYLDFTAGIGVTSTGHCHPHVVEAARRQIG
SLIHGQYTTVMHRPLLELTERLGTVLPEGLDSLFFANSGSEAVEAALRLARQATGRPGIV
VFHGGFHGRTVAAATMTTSGTRFSAGFSPLMGGVHVAPFPTAYRYGWSEEEATDFALQEL
DYLFATLVAPDEIAAFVVEPVLGEGGYVPGNTRFFQGLRQRADEHGILLVFDEIQTGFGR
TGKFFGHQHFDVRPDIITIAKGLASGFPLSGIAASEELMERARPGSQGGTYGANAVSCAA
AVATLDVIEKEGLVDNAAARGRELLSGARENTIDAIGDVRGLGLMVGLEFTTDGAPDRER
ASAAQQLAAQKGLLLLTCGAHMNVVRMIPPLIVTTRQIEDALGIWSEVLAEVR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtctttcaccccgcctgctgcaggcaacgcccgtcaccgtcgaccacgccgag
gggtgctacatccacggcaccgacggacgtcggtatctcgacttcaccgccggcatcggc
gtcacgagtaccggccactgtcacccgcacgtcgtcgaggccgcccgccggcagatcggc
tcgctgatccacgggcagtacacgaccgtgatgcaccggcccctgctcgaactcaccgaa
cgcctgggcacggtgctccccgaaggactcgactcgctgttcttcgccaattcgggcagc
gaggcagtcgaggcggcgctgcgtctggcccgccaggcgacagggcgacccggaatcgtc
gtcttccacggcggtttccacggccgtaccgtcgccgccgccacgatgaccacctccgga
acccgtttctccgcagggttctcgccgctcatgggcggtgtacacgtcgctcccttcccc
acggcctatcgctacggctggtcggaggaggaagcgaccgatttcgccctgcaggaactg
gactacctgttcgcgaccctcgtggcgccggacgagatcgcggccttcgtcgtcgaaccg
gtcctgggcgagggcggttacgtccccggcaacaccaggttcttccagggactgcggcag
cgggccgacgaacacggcatcctgctcgtcttcgacgagatccagaccggattcgggcgg
accggaaagttcttcgggcatcagcacttcgacgtgcgacccgacatcatcacgatcgcc
aagggcctcgcgagcggtttcccgctgtcgggtatcgccgcctccgaggaactcatggag
cgcgcccgtccgggatcgcagggcggcacgtacggagctaatgcggtctcctgcgcggcg
gccgtggccactctcgacgtgatcgagaaggaggggctcgtcgacaacgccgccgcacgt
ggacgtgaactgctctccggtgcacgggagaacacgatcgacgccatcggcgacgtgcgc
ggcctcggcctcatggtgggcctcgagttcactaccgacggagcacccgaccgggagcgg
gcgtccgcagcgcagcagctcgccgcgcagaaggggttgctgctgttgacctgcggtgcg
cacatgaacgtggtgcgcatgatcccgccgctgatcgtcaccacccggcagatcgaggat
gcgctcgggatctggtccgaggtcctcgccgaggtccgataa

DBGET integrated database retrieval system