KEGG   Rhodococcus biphenylivorans: CEJ39_07215Help
Entry
CEJ39_07215       CDS       T05830                                 

Definition
(GenBank) YihY/virulence factor BrkB family protein
  KO
K07058  membrane protein
Organism
rby  Rhodococcus biphenylivorans
Brite
KEGG Orthology (KO) [BR:rby00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    CEJ39_07215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB Sec61_beta
Motif
Other DBs
NCBI-ProteinID: AWZ23998
UniProt: A0A2Z4VFM1
LinkDB All DBs
Position
1509112..1510233
Genome map
AA seq 373 aa AA seqDB search
MDAEHRGDGSSGATLAPDDPRKPDSPTDLSTPSWKYVLRRTIREFSRDQCTDLAAALTYY
AVLSLFPALLVVVSLLGVFGQGQTTVDTVLGMVEDLGPSSAVDTLRGPIEQLVSAPTAGF
ALIVGILGALWSASGYVGAFGRAMNRIYEIEEGRPVWKLRPLMLLITAVALVAAGTTALM
LVISGPVARTIGDVIGLGDTAVTVWNIVKWPVMLALVVMIVAVLYYATPNVSQPKFRWVS
LGSLIAIVVWIVASVAFAFYVSNFGSYNKTYGSLAGAVIFLLWLWITNLALLFGAEFDAE
MERGRQLQAGMPAEKTLQLPERDSRASEKNAAKLEELVEHGRKLREAHNADGSSGEAADP
VGPTGPTTERNPR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgagcacagaggtgatggatcgtcgggtgccaccctcgcccccgatgacccg
cgcaaacccgactcaccgaccgatctgtccacgccgtcgtggaaatatgtgctgcgcagg
acgattcgggagttcagtcgggaccagtgcaccgatctcgcagccgcactgacgtactac
gccgtcctgtcgctgttccctgcgctgctcgtcgtggtctcgttgctcggcgtgttcggc
cagggacagacgacggtcgacaccgtgctcggcatggtcgaggacctcggcccgtcctcc
gccgtcgacaccctgcgaggaccgatcgaacagctcgtgtccgcaccgacagccggattc
gccctgatcgtcggtattctcggcgcgctgtggtcggcctcgggatatgtcggcgccttc
ggccgcgccatgaaccggatctacgagatcgaagagggccggcccgtctggaagctgcgt
ccgctgatgctgctgatcaccgctgtggccctggtggccgccgggacgaccgccctgatg
ctcgtgatcagcggcccggtcgcacgcacgatcggcgacgtcatcggcctcggcgacacc
gccgtgacggtgtggaacatcgtcaagtggcccgtgatgcttgcgctggtggtcatgatc
gtcgcggtgctgtactacgcgacgcccaacgtgtcccagccgaagttccgctgggtcagc
ctcggatcgctcatcgcgatcgtcgtgtggatcgtggcttcggtggcattcgccttctac
gtctcgaatttcggcagctacaacaagacctacggctcactcgccggtgcggtgatcttc
ctgttgtggttgtggatcaccaatctggccttgttgttcggtgccgagttcgacgccgag
atggaacgtggccgccagctgcaggccggtatgcctgccgagaagacattgcaactgccc
gaacgtgattcgcgcgcgagcgagaagaacgccgccaagctggaggaactcgtcgagcac
gggcggaagctgcgcgaagcccacaacgccgacggctcctccggagaggcggccgacccc
gtgggccctaccgggcccacgacggaaaggaatccgcgatga

DBGET integrated database retrieval system