KEGG   Rhodococcus biphenylivorans: CEJ39_07450Help
Entry
CEJ39_07450       CDS       T05830                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rby  Rhodococcus biphenylivorans
Pathway
rby03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rby00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CEJ39_07450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rby03400]
    CEJ39_07450
Enzymes [BR:rby01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CEJ39_07450
DNA repair and recombination proteins [BR:rby03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CEJ39_07450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S Big_4
Motif
Other DBs
NCBI-ProteinID: AWZ24038
UniProt: A0A2Z4VFS4
LinkDB All DBs
Position
1553068..1555422
Genome map
AA seq 784 aa AA seqDB search
MPTRTIGGHRITLTNLDKVLYPSTGTTKGEVVEYYEAVAEAMLPHIVGRAATRNRWPNGV
GEQSFFEKNLPDHAPAWLDRRTLHHKDRRVTYPLFDSAAGLVWLGQQAALELHVHQWRFD
GEKVGPATRIVFDLDPGPGVGLAECAEVARHVRDTVAELGWSAYPVTSGSKGIHLYVPLD
RMLSSSGASKVAKQVARNLETTLPDLVTATMAKSAREGKVFVDWSQNNSSKTTVAPYSLR
GRDEPWVAAPRSWDELDDPDLAQLQFREVLARIEEFGDLLAGLDPPLGKAVSGGKTVSGG
DALDTYRGKRDASRTPEPVPDRVPDDGPGNRFVIQEHHARRLHYDLRLERDGVLASWAVP
KNLPDTSGRNNLAVRTEDHPIEYLTFHGTIPKGEYGAGSMTVWDTGTYETEKWRDDEVIV
RFHGDRIEGRYALIRTEKNQWLAHRMKDQSSPSTESSDADPTSLVGLSGSKAFPRDLAPM
LATSGDVSGLDAEDWAFEGKWDGYRAIAEIEDGTVRLRSRSGRDVTGDYRKLVELATILD
GHRAVLDGEIVAVDRSGVTSFSMLQRGVNYEYRVFDVLYLDGVSLLRKTYDDRRRVLEAL
AAATDGLIVPDLLSGDGSKALARSRAKNWEGVVAKRRDSVYLPGKRGAGWIKSKNWLTQT
VVLGGYRRGNGNRASTFGSLLLGVYDDDGEFVYVGKVGTGFDDETLLSVAKAVKGRMSRT
NPFANEVPAAERRDAVWLRPDLVGEVRFGGWTEGDRVRHASWRGLRDDVDASSVVREEET
GADC
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgccgacccggacgatcggtggtcaccgcatcaccctgaccaacctcgacaaggtgctg
tatccgagcaccgggacgacgaagggcgaggtcgtcgagtactacgaagccgtcgccgag
gcgatgcttccccacatcgtcggccgggcagcgacccgtaatcggtggccgaacggtgtc
ggcgaacagtccttcttcgagaagaacctccccgaccacgcaccggcctggctcgaccgt
cgcaccctgcatcacaaggaccggcgggtcacctacccgctgttcgattccgccgccggg
ctcgtctggctcgggcaacaggcagccctcgaactccacgtgcaccagtggcgtttcgac
ggagagaaggtcggacccgcgacccgcatcgtcttcgacctcgacccggggcccggcgtg
ggcctggccgagtgtgcggaggtcgcgcgccacgtgcgcgacaccgtcgccgaactcggg
tggtcggcctatccggtcaccagcggcagcaagggcatccacctgtacgtcccgctcgat
cggatgctgtcgtcgtcgggggcgtcgaaggtcgcgaagcaggtcgcgcgcaatctcgag
accacccttcccgacctggtgaccgcgacgatggcgaaatcggcgcgcgagggcaaggtc
ttcgtcgactggagccagaacaacagttccaagacgacggtcgcgccgtactcgctgcgc
ggtcgcgacgagccgtgggtggcggcgccgcgcagctgggacgaactcgacgaccccgac
ctcgcgcaactgcagttccgggaggtcctcgcccgcatcgaggagttcggggacctgctc
gccggtctcgacccgcccctcggcaaggctgtgtccggcggcaagaccgtgtccggcggc
gacgccctggacacctaccgcggcaagcgcgacgcgtcgcgcaccccggaaccggtaccc
gaccgcgtccccgacgacggccccggcaacaggttcgtcatccaggagcaccacgcgcgt
cgcctgcactacgacctgaggctcgaacgcgacggtgtgctggcgtcgtgggccgtaccg
aagaacctgccggacacctcggggcgcaacaatctcgcggtacggaccgaggaccacccg
atcgagtacctgaccttccacgggacgatcccgaagggcgaatacggcgccggcagcatg
accgtgtgggacaccggcacctacgagaccgagaagtggcgggacgacgaggtgatcgtg
cggttccacggcgaccggatcgagggacggtacgcgctgatccgcaccgagaagaaccag
tggctggcgcaccgcatgaaggaccagtcgtcgccgagcaccgagtcgtccgatgccgat
ccgacctccctcgtcggattgtcggggtccaaggccttcccgcgcgatctcgcgcccatg
ctcgcgacctccggtgacgtctcgggtctcgacgccgaagactgggcgttcgaaggcaaa
tgggacggataccgcgccatcgcggagatcgaggacggcaccgtcaggctccgcagccga
tccggtcgcgatgtcaccggcgactaccggaagctcgtcgaacttgcgacgatcctcgac
ggtcaccgggcggtgctcgacggggagatcgtcgccgtcgaccgctccggggtgacgagc
ttctcgatgctgcagcggggcgtgaactacgagtaccgcgtgttcgacgtgctgtatctc
gacggggtgtcgctgctgcgcaagacctacgacgatcgccgacgggtcctcgaggcgctc
gccgctgccacggacggactgatcgtcccggatctgctctcgggtgacggctcgaaggct
ctcgcgcgcagccgcgcgaagaactgggagggcgtggtcgccaaacgccgggactccgtg
tatctgccgggcaagcgcggcgccggatggatcaaatcgaagaactggctcacccagacc
gtcgtgctcggcggataccgccgtggcaacggcaaccgtgcctcgaccttcggctccctg
ctgctcggcgtctacgacgacgacggtgagttcgtgtacgtcggcaaggtcggcaccggt
ttcgacgacgagacgctcctgtcggtggcgaaggctgtgaaagggcgcatgagccgcacg
aacccgttcgcgaacgaagtgccggccgccgaacgccgcgatgcggtgtggttgcggccc
gatctcgtgggggaggtgcggttcggaggatggacggaaggagaccgggtgcggcacgcg
agctggcgtggtctgcgcgacgatgtggacgcgtcgagtgtggtgcgagaagaggaaaca
ggcgctgactgctaa

DBGET integrated database retrieval system