KEGG   Rhodococcus biphenylivorans: CEJ39_10575Help
Entry
CEJ39_10575       CDS       T05830                                 

Gene name
atpD
Definition
(GenBank) F0F1 ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
rby  Rhodococcus biphenylivorans
Pathway
rby00190  Oxidative phosphorylation
rby01100  Metabolic pathways
Module
rby_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:rby00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CEJ39_10575 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:rby00194]
    CEJ39_10575 (atpD)
Enzymes [BR:rby01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     CEJ39_10575 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     CEJ39_10575 (atpD)
Photosynthesis proteins [BR:rby00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   CEJ39_10575 (atpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RsgA_GTPase ATPase T3SS_ATPase_C AAA AAA_25 AAA_16 RNA_helicase AAA_19 ATPase_2 DUF2806 NB-ARC
Motif
Other DBs
NCBI-ProteinID: AWZ24574
UniProt: A0A2Z4VHB2
LinkDB All DBs
Position
2248533..2249981
Genome map
AA seq 482 aa AA seqDB search
MTAAVTDNNAGAASALAGRVVRVIGAVVDVEFPRGAVPELFNALHAEVTLPSVAKTLTLE
VAQHLGDNLVRTISMQPTDGLVRGAPVSDTGKPISVPVGDVVKGHVFNALGDCLDAPGTG
RDGEQWGIHRKPPAFDQLEGKTEILETGIKVIDLLTPYVKGGKIGLFGGAGVGKTVLIQE
MITRIAREFSGTSVFAGVGERTREGTDLHLEMEEMGVLQDTALVFGQMDEPPGTRMRVAL
SALTMAEYFRDVQGQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGELQE
RITSTRGRSITSLQAIYVPADDYTDPAPATTFAHLDATTELSRPISQMGIYPAVDPLTST
SRILEPGIVGADHFRVANEVKRILQKYKELQDIIAILGMDELSEEDKVTVARARRLQKFL
GQNFIVAEKFTGQPGSVVPLADTIEAFDRVCKGEFDHLPEQAFNSCGGLDDVEAAAKKIA
GK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagcagtaaccgacaacaacgccggtgcggcgtcggcccttgccgggcgcgtc
gtccgcgtcatcggcgccgtcgtcgacgtggaattcccgcgtggcgccgtgcccgagctg
ttcaacgccctgcacgcagaggtcactctgccgtccgtggcgaagaccctgaccctcgaa
gtcgcgcagcacctgggtgacaacctggtccgcacgatctcgatgcagcccaccgacggc
ctggtgcgtggcgcccccgtcagcgacaccggcaagccgatctcggttcccgtcggcgac
gtcgtcaagggccacgtgttcaacgcgctgggcgactgcctcgacgcgccgggcaccgga
cgcgacggcgagcagtggggcatccaccgcaagcccccggccttcgaccagctcgagggc
aagaccgagatcctcgagaccggcatcaaggtcatcgacctgctgaccccgtacgtgaag
ggcggcaagatcggtctgttcggtggtgccggtgtcggcaagaccgttctgatccaggag
atgatcacccgtatcgcgcgtgagttctccggtacgtcggtgttcgccggcgtcggtgag
cgcacccgtgagggcaccgacctccacctcgagatggaagagatgggcgtcctccaggac
accgccctcgtcttcggccagatggacgagccgccgggcacgcgtatgcgcgtcgccctg
tcggccctgacgatggcggagtacttccgcgacgtccagggacaggacgtgctcctgttc
atcgacaacatcttccgcttcacgcaggccggctcggaggtttcgaccctcctcggccgt
atgccgtcggccgtgggttaccagcccacgctcgcggacgagatgggtgagctccaggag
cgcatcacctcgacgcgtggccgctcgatcacctcgctgcaggcgatctacgtgcccgcc
gacgactacaccgaccccgcgccggccacgacgttcgctcacctcgatgcgaccaccgag
ctctcgcgtccgatctcgcagatgggtatctaccccgctgtggacccgctgacgtcgacc
tcgcgaatcctcgagccgggcatcgtcggtgccgaccacttccgggtggccaacgaggtc
aagcgcatcctgcagaagtacaaggaactgcaggacatcatcgccatcctcggtatggac
gagctctccgaagaagacaaggtcacggtcgcccgtgcccgtcgtctccagaagttcctc
ggccagaacttcatcgtcgccgagaagttcacgggtcagccgggttcggtcgtgccgctc
gccgacaccatcgaggccttcgaccgcgtgtgcaagggcgagttcgaccacctgcccgag
caggcgttcaacagctgcggtggactcgacgacgtcgaggctgcagccaagaagatcgcc
ggaaagtag

DBGET integrated database retrieval system