KEGG   Rhodococcus biphenylivorans: CEJ39_12040Help
Entry
CEJ39_12040       CDS       T05830                                 

Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
rby  Rhodococcus biphenylivorans
Brite
KEGG Orthology (KO) [BR:rby00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rby03012]
    CEJ39_12040
   03029 Mitochondrial biogenesis [BR:rby03029]
    CEJ39_12040
Translation factors [BR:rby03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    CEJ39_12040
 Prokaryotic type
   CEJ39_12040
Mitochondrial biogenesis [BR:rby03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CEJ39_12040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU IF-2 IF2_N GTP_EFTU_D2 Ras MMR_HSR1 SRPRB Roc MMR_HSR1_Xtn Arf
Motif
Other DBs
NCBI-ProteinID: AWZ24813
UniProt: A0A2Z4VIE2
LinkDB All DBs
Position
2557618..2560497
Genome map
AA seq 959 aa AA seqDB search
MAGKARVHELAKELGVTSKELLARLKEQGEFVKSASSTVEPPVARRLRESFGKTEGDAAA
KAAPNPAPKPGAPRPGPRPTPASPAPAAETARPKPGAPKPAAPKPAPAPEEPAAPAPQAP
AAQAAPQSPAAQAPSATPQAPAAKPGPKPAGPRPGPKTPRVGNNPYSSAPAERPAPRPGA
PRPGPGGPRPTPGQGGPRPTPGQGRPAAGPGGPRPGPGQAGPRPAPGQGGPRPAPGQGGP
RPSPGSMPPRPNPGAMPQRAARPAASGRPGRPGGAPGGRPGGGGGGYRGGGAGGGAPAGA
GAPGGFRGRPGGGGGGRGRGGAAGAFGRPGGAPRRGRKSKRQKRQEYDSMQAPSVGGVRL
PRGNGETIRLARGASLSDFAEKIDANPSALVQALFNLGEMVTATQSVNDDILELLGSEMN
YVVQVVSPEDEDRELLESFDIQYGEDEGGEEDLQQRPPVVTVMGHVDHGKTRLLDTIRKE
NVGEGEAGGITQHIGAYQVMTHLNGEDRLITFIDTPGHEAFTAMRARGAKATDIAILVVA
ADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGANPQKIRQQLTEYGLVAEEYGGDTMF
VDISAKQNLNIDQLLEAVLLTADAALDLRANPDMEAQGVAIEAHLDRGRGPVATVLIQRG
TLRVGDSIVAGDAYGRVRRMVDEHGEDVLEALPSRPVQVVGFTSVPGAGDNLVVVEEDRI
ARQIADRRNARKRNALAARSRKRISLEDLDAALKEHNELNLILKGDNSGTVEALEEALMG
IEIDDEVRLRVIDRGVGGVTETNVNLAAASNAVIIGFNVRAEGKATELANREGVDIRYYS
VIYQAIDEVEKALKGMLKPIYEEVELGRAEIRAIFKSSKVGNIAGCLVQSGIVKRNAKAR
LIRDSNVVAETVTISSLRREKDDVTEVREGFECGLTITYSDIKVGDVIEAYELREKPRD
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggcaaggcccgcgtgcacgagttggcgaaagaactcggtgtcaccagcaaggaa
ctactcgcacgcctgaaggaacagggcgagttcgtcaagtccgcgtcgtcgaccgtcgaa
ccgccggtcgcgcgtcgactgcgcgaatcgttcggtaagaccgaaggcgatgcagccgcg
aaggctgcacccaaccccgcaccgaagcccggtgccccccggccgggtccccggcccacc
cctgcgagcccggcccccgcggccgaaaccgcgcgtccgaagcccggcgcaccgaagccg
gctgctcccaagcccgctccggcaccggaggagcccgcggctcccgcgccgcaggccccc
gctgcccaggcggcaccgcagtccccggctgctcaggctcccagcgcgacgccgcaggct
cccgcggccaagcccggccccaagccggccggtccgcgtccgggtccgaagaccccgcgc
gtcggtaacaacccgtactcctcggctccggccgagcgtcccgctccgcgtccgggtgcc
ccgcgccccggcccgggcggaccgcgtcctacccccggacagggcggcccccgccccacg
cccggacagggacgtcccgcagcaggccccggtggcccgcgtcccggacccggccaggcc
ggtccgcgtccggctcccggacagggcggtccccgccccgcgcccggacagggcggtccc
cgtccgtccccgggttcgatgcccccgcgtcccaacccgggtgcgatgccgcagcgtgct
gcgcgtccggccgcatccggtcgtccgggtcgtccgggcggagctcccggtggacgtccc
ggtggtggcggcggcggctaccgcggtggcggcgccggtggcggcgcacctgcaggtgca
ggtgctcccggtggtttccgcggtcgccccggtggcggtggcggtggacgcggtcgcggc
ggtgcagccggcgcgttcggtcgtcccggtggcgctccgcgtcgtggtcgtaagtcgaag
cggcagaagcggcaggaatacgattcgatgcaggcgccgtcggtcggcggcgtgcggttg
ccgcgtggcaacggcgagaccatccgtctcgctcgcggcgcatcgctgtccgacttcgcc
gagaagatcgacgcgaacccgtcggccctggtgcaggcgctgttcaacctcggtgagatg
gtcacggccactcagtcggtgaacgacgacatcctcgagctgctcggctcggagatgaac
tacgtcgtgcaggtcgtctcgcccgaggatgaggaccgcgagctgctcgagtcgttcgac
atccagtacggcgaggacgagggcggcgaggaagacctccagcagcgtccgccggtggtc
accgtcatgggtcacgtcgaccacggcaagacccgcctgctcgacacgatccggaaggag
aacgtcggcgagggtgaggccggtggcatcacccagcacatcggtgcctaccaggtgatg
acgcacctcaacggtgaagatcgcctgatcaccttcatcgacaccccgggtcacgaggcg
ttcaccgcgatgcgtgcccgcggcgcgaaggcgacggacatcgcgatcctcgtggtcgca
gccgacgacggcgtcatgccgcagacggtggaggcgatcaaccacgcacaggccgccgat
gtcccgatcgtggtcgcggtgaacaagatcgacaaggagggtgcgaaccctcagaagatc
cgtcagcagctcaccgagtacgggctggtggcggaggagtacggcggcgacaccatgttc
gtcgacatctccgcgaagcagaacctcaacatcgaccagctgcttgaagcggtgctgctc
accgccgacgcagcgctcgatctgcgggccaacccggacatggaggcgcagggcgtcgcc
atcgaggcgcacctcgaccgcggtcgcggtccggtggccacggtgctcatccagcgcggc
actctgcgggtcggcgactcgatcgtcgccggcgacgcctacggccgcgtgcgccgcatg
gtcgacgagcacggcgaggacgtgctcgaggcactgccttcgcgtccggtccaggtcgtc
ggcttcacgtcggtgcccggcgccggggacaacctcgtcgtcgtcgaagaggaccgcatc
gcgcgtcagatcgccgaccggcgtaatgcccgcaagcgcaacgcgctcgcagcacgtagc
cgtaagcgcatcagcctcgaggatctcgatgccgctctcaaggagcacaacgagctcaac
ctcatcctcaagggcgacaactcgggtaccgtcgaggccctcgaagaggcgctcatgggt
atcgagatcgacgacgaggtgcgcctgcgggtcatcgaccgcggtgtcggtggcgtcacc
gagaccaacgtcaacctcgctgccgcgtcgaacgccgtgatcatcggcttcaacgtccgc
gccgagggcaaggccaccgagctcgcgaaccgcgagggtgtcgacatccgctactactcg
gtcatctaccaggcgatcgacgaggtggagaaggccctcaagggcatgctcaagccgatc
tacgaggaggtcgagctcggccgcgccgagatccgcgcgatcttcaagtcgtcgaaggtc
ggcaacatcgcgggttgcctcgtgcagtccggcatcgtcaagcgcaacgcgaaggcccgc
ctcatccgcgacagcaacgtcgtggccgagacggtcaccatctcgtcgctgcgccgcgag
aaggacgacgtcaccgaggtccgcgagggcttcgagtgcggtttgacgatcacctactcc
gacatcaaggtcggcgacgtgatcgaggcgtacgagttgcgcgagaagccgcgcgactga

DBGET integrated database retrieval system