KEGG   Rhodobacteraceae bacterium G7: B9057_03990Help
Entry
B9057_03990       CDS       T05514                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
rbz  Rhodobacteraceae bacterium G7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C AIRS_C 2-Hacid_dh_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AUJ63520
UniProt: A0A2K9JKD1
LinkDB All DBs
Position
783503..784537
Genome map
AA seq 344 aa AA seqDB search
MRAAVVRDFNEDLSIETVEDPKCPSNGVVLEVAACGVCRSDFHGWVGGHPKVVNGSIMGH
EYCGTVVEAGPQAKHKVGDKLIAPFILGCGDCPACQTGASNSCESAIVPGFGAPGAYAEF
VAVPLDHNLVHLPDTLSPALAAGLGCRVTTAWHALTDRANVRAGEWVAVHGTGGIGLSAL
LLAKMLGARVVVVDVVEEKLTHAKQLGADAAVNAAHGNVAEAIRDITGGGAQVSLEALGI
DATTNASVECLATLGRHVHVGMPAGDGMMQINMRAIYSKQLAFYGTRGMPAWKYPSLLGM
IERGEVDLTPMLDRVVSLSDASAELRAMKGPTRPGTAVITDFKN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagccgttgtcagagacttcaacgaagacctatctatcgaaactgttgaggat
ccaaaatgccccagcaatggtgttgtgctggaggtcgcggcttgcggcgtgtgccggtcc
gatttccatggttgggtcggcgggcatcccaaagtggtaaacgggtccatcatggggcac
gaatactgcggcaccgttgtcgaagccggtccgcaggccaaacacaaggttggcgacaag
ttgatcgcgccgttcattttggggtgcggtgattgccccgcctgccaaacgggcgcgtcc
aattcttgcgaaagcgcgatcgttccggggtttggtgcaccaggcgcgtacgcggagttt
gtggctgtgccgcttgatcacaatttggttcacttgcccgacacgctctcgcctgcgttg
gctgctgggttgggttgccgtgtgacaactgcgtggcatgctctgaccgaccgcgcgaac
gtcagggctggtgaatgggttgctgtgcacggcacgggcggcatcggtctttcggcgctg
ttgttggcgaaaatgctgggcgcgcgcgtcgtggttgtggatgtggtcgaggaaaagctt
acccatgccaaacagctgggtgctgatgccgcggtcaatgccgcgcatgggaatgtcgcc
gaagcaatccgcgacattactggtgggggcgcgcaggtctctcttgaggcgcttggcatt
gacgccactaccaatgcgtccgtggaatgccttgcaacccttggccgccatgtccatgtc
ggcatgccagcgggggatggtatgatgcagatcaatatgcgcgccatttattccaaacaa
cttgcgttttacggaacccgcggcatgccagcgtggaaatatccgtcattgctggggatg
atcgaacgcggtgaagtcgatctgacacctatgcttgaccgggtggtttcgctgtctgac
gcaagcgcagagttgcgcgcgatgaaggggccaacccgtccggggacagccgtcatcacc
gatttcaagaattaa

DBGET integrated database retrieval system