KEGG   Rhodobacteraceae bacterium G7: B9057_05680Help
Entry
B9057_05680       CDS       T05514                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rbz  Rhodobacteraceae bacterium G7
Pathway
rbz00010  Glycolysis / Gluconeogenesis
rbz00020  Citrate cycle (TCA cycle)
rbz00620  Pyruvate metabolism
rbz01100  Metabolic pathways
rbz01110  Biosynthesis of secondary metabolites
rbz01120  Microbial metabolism in diverse environments
rbz01130  Biosynthesis of antibiotics
rbz01200  Carbon metabolism
Module
rbz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B9057_05680
   00020 Citrate cycle (TCA cycle)
    B9057_05680
   00620 Pyruvate metabolism
    B9057_05680
Enzymes [BR:rbz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B9057_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N DUF2118 QRPTase_N Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AUJ63831
UniProt: A0A2K9JLF9
LinkDB All DBs
Position
complement(1123001..1124299)
Genome map
AA seq 432 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLVKEGDEVKSGDIIAEIETDKATMEFEAVDEGIVGKIV
IAEGTEGVKVNSLIAILVEEGEEVPAAGASAPAAAPAAAAPVAATAPAAAAPAPAAPVKD
GNRVFASPLARRIAGQKGLDLSAIAGSGPRGRIVKSDVEGATAAPKAAAPAAAATEAPKA
AAPAAAMAQGPSTDAVLKMYEGTDFEEVKLDGMRKTIAARLTEAKQSVPHFYLRRDIELD
DLLAFRAQLNAKLGDRGVKLSVNDFIIKACALALQQIPEANAVWAGDRVLKFKNSDVAVA
VAIEGGLFTPVLKNSDSKSLSALSAEMKDLAKRARDRKLAPHEYQGGSFAISNLGMFGID
NFDAIINPPHSGILAVGAGVKKPVVGADDQIKVATVMSVTLSVDHRVIDGALGAQLLEAI
KANLENPIAMLA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggctacagaaattctcatgcccgccctgtcccccacgatggaggaaggcacgctggcc
aaatggctggtcaaagagggcgacgaagtaaaatcgggcgacatcatcgctgagatcgaa
accgacaaagccaccatggaattcgaagccgtggacgaaggcatcgtcggcaagatcgtc
atcgctgagggcaccgagggcgttaaggtcaacagcctgatcgcaatcctcgtcgaagag
ggcgaagaggttccagcagcgggcgcatctgcacctgctgcggcccctgcggcggcggct
cctgtcgcggcgacggctcctgcggctgcggcacctgccccagcagcacctgtcaaagac
ggcaaccgcgtctttgcatcgccactcgcgcggcgcatcgcaggtcaaaaaggtctcgac
ctgtctgccatcgctggctctggcccgcgtggtcgcatcgtgaaatcggacgttgaaggt
gcaaccgctgcacccaaagctgccgctcctgctgccgctgcgaccgaggctcccaaggct
gcggctcctgctgctgccatggcccaaggtccgtccaccgatgccgtgctcaaaatgtac
gaaggcaccgatttcgaggaagtcaaactcgacggtatgcgcaaaaccatcgctgcccgc
ctcaccgaggcaaagcagtcggttccgcacttctacctgcgccgcgacatcgaactggac
gatctgcttgccttccgtgctcagctcaatgcgaaactcggcgaccgtggcgtcaaactc
tcggtcaacgatttcatcatcaaagcctgcgcattggccctgcaacaaatcccagaagcc
aacgccgtttgggctggcgaccgcgtgctgaagttcaaaaactccgacgtggctgtggct
gtagccatcgaaggcggcttgttcactccagttctcaaaaactcggacagcaaatcgctc
tcggctctgtcggcagagatgaaagacctcgccaaacgtgcccgcgaccgcaaactcgcg
ccgcatgaatatcagggcggttcgttcgcaatctcgaacctcggcatgttcggcatcgac
aacttcgacgccatcatcaacccgccgcactctggcatcctcgccgttggcgcgggcgtg
aagaaacctgtggttggcgctgacgaccagatcaaagtggcgaccgtcatgtccgtcacc
ctctccgttgaccaccgcgtgatcgacggcgcactgggcgcacaactcctcgaggcaatc
aaagcgaacctcgaaaacccgattgcgatgctggcctaa

DBGET integrated database retrieval system