KEGG   Rhodobacteraceae bacterium G7: B9057_09200Help
Entry
B9057_09200       CDS       T05514                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rbz  Rhodobacteraceae bacterium G7
Pathway
rbz00473  D-Alanine metabolism
rbz00550  Peptidoglycan biosynthesis
rbz01100  Metabolic pathways
rbz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B9057_09200
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B9057_09200
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B9057_09200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rbz01011]
    B9057_09200
Enzymes [BR:rbz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B9057_09200
Peptidoglycan biosynthesis and degradation proteins [BR:rbz01011]
 Precursor biosynthesis
  Amino acid ligase
   B9057_09200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATPgrasp_ST ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AUJ65480
UniProt: A0A2K9JQP7
LinkDB All DBs
Position
complement(1853932..1854822)
Genome map
AA seq 296 aa AA seqDB search
MAVLMGGPSAEREVSLSSGKECVAALQAAGFQTIAIDAGADLAARLDAERPDVVFNALHG
RWGEDGCVQGLLEWLRIPYTHSGVLASALAMDKEKTKAAYRAAGLPVVESILATKAEVAS
RHVMPAPYVVKPYNEGSSVGVYIVQEGANTPPDLSDDMPDVLMVEAFVPGRELTTAVMGD
RALGVTDIITDGWYDYTAKYTTGGSRHVIPADIPAEIYEACLDYAVRAHQALGCRGLSRT
DFRWDEARGLDGLILLETNTQPGMTPTSLAPEQAAHAGVDFPSLCKWLVEDATCDR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtggctgtgttgatgggtggaccgtcggctgaacgtgaggtgtccctctcgtccggcaaa
gagtgtgtcgccgcgctacaggctgctgggttccagacaatcgcgattgatgcgggcgcc
gatttggcggcacgccttgatgcggaacgtcctgacgtcgtgttcaatgctctgcatggt
cgttggggcgaggacggttgcgtccaaggtctgctcgagtggctgcgcatcccttacacc
cattctggcgtgttggcctctgccctcgcgatggacaaagagaagaccaaggcggcttat
cgtgcggctggtttgcctgttgtggaaagcatcctcgcgaccaaggctgaggtggcgtcg
cgccacgtgatgcctgcgccttatgtcgtgaaaccctataacgaaggctcctctgtcggg
gtttatatcgtccaagaaggtgcgaacacaccgcctgacctgtccgacgatatgcctgac
gttctgatggtcgaagcctttgttcccggtcgtgaattgaccacggcagtgatgggggat
cgggcgcttggcgtgaccgacattatcactgacggctggtatgattacaccgcgaaatat
acgacgggcggatcgcgccatgtgatccccgccgatatccctgcagagatttatgaggcc
tgcctcgattacgctgttcgggcgcatcaggcgcttggctgtcgtgggttgtcgcgtacg
gattttcgttgggatgaggcacgtggtctggacggtctgatcctacttgagacgaatacc
caaccggggatgacgcctacgtcgcttgcgcctgaacaggctgcgcatgctggcgttgat
ttcccgtcgctctgcaaatggctggtggaggacgcaacatgcgaccgctaa

DBGET integrated database retrieval system