KEGG   Rhodobacteraceae bacterium G7: B9057_09215Help
Entry
B9057_09215       CDS       T05514                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
rbz  Rhodobacteraceae bacterium G7
Pathway
rbz00471  D-Glutamine and D-glutamate metabolism
rbz00550  Peptidoglycan biosynthesis
rbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rbz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B9057_09215
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B9057_09215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rbz01011]
    B9057_09215
Enzymes [BR:rbz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     B9057_09215
Peptidoglycan biosynthesis and degradation proteins [BR:rbz01011]
 Precursor biosynthesis
  Amino acid ligase
   B9057_09215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase Mur_ligase_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AUJ64473
UniProt: A0A2K9JN52
LinkDB All DBs
Position
complement(1856148..1857548)
Genome map
AA seq 466 aa AA seqDB search
MNSATKLPIDVGAIHFVGIGGIGMSGIAEVLVNFGYTVQGSDAKTSKITDRLAGMGATIF
EGQAAENLKDAQVVVISSAIKPGNPELDEARRRGLPIVRRAEMLAELMRLKSNVAVAGTH
GKTTTTTMVSALLDHGNFDPTVVNGGIIHAYGSNARVGEGEWMVVEADESDGTFNRLPAT
IAIVTNIDPEHMEHWGSIENLRKGFYDFVSNIPFYGVAVCCTDHPEVQSLVGKITDRRVI
TYGFNTQADVRAINLHYKAGVAHFDVALQVEDDVIEGCTLPMPGDHNVSNALSAVAVARH
LGMKKDEIREALAKFGGVNRRFTKVGEVLGGVTIIDDYGHHPVEIAAVLKAARQACDGRV
IAVHQPHRYSRLSSLFEDFCSCFNEADVVAIAEVYAAGEQPIEGASRDDLVAGLIRHGHR
HARALISEEDLERLVREQARPGDMVVCLGAGTISTWANNLPERMKA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaactctgcaaccaaactgcccatcgatgttggtgccatccattttgtcgggattggc
ggcatcggtatgtctggcatcgccgaagttttggtgaactttggctacacggtgcagggg
tcggacgcaaaaacgtcaaagatcacagatcgtctggcaggcatgggtgcgaccattttc
gaaggtcaggccgccgaaaacctcaaagacgcgcaggtcgttgtgatttcctcggcgatc
aaaccgggtaaccctgaattggacgaagcccgccgtcgtggcctgccgattgtgcgccgc
gcggaaatgctggccgaattgatgcgtctgaaatcgaacgtcgctgttgcgggtacgcac
ggtaaaacgaccaccaccacgatggtgtcggcgctgttggatcacggtaattttgacccg
actgttgtgaatggcgggatcattcacgcatacgggtcgaacgcgcgtgtgggcgaaggc
gaatggatggtggtcgaggcggatgaatccgacggcacttttaaccgcctgcctgcaacg
atcgcgattgtgaccaacatcgacccagagcatatggagcactggggcagcatcgaaaac
ctacgcaaagggttttacgatttcgtctcgaacatcccgttttatggtgtggctgtgtgc
tgcaccgatcaccccgaggttcagtctctcgtcggtaaaatcactgaccgccgcgtgatc
acctatggctttaacacgcaggccgatgtccgtgcgatcaacctgcattacaaagcaggc
gttgcgcattttgatgtggcgcttcaggtcgaggacgacgtgatcgaaggctgcaccttg
ccgatgccgggggatcacaacgtatcgaacgcgctgtctgcggtcgcagttgcacgtcac
ctcggcatgaaaaaggacgaaatccgcgaggcactggccaagtttggcggcgtgaaccgt
cgctttaccaaggtgggtgaagtcctcggtggcgtgaccatcattgacgactacggccac
caccctgtcgaaattgccgccgtgctcaaggccgcgcgtcaggcttgtgatggccgcgtg
atcgctgttcaccagccacaccgctacagccgtctgtcgtcgctgttcgaggatttctgc
tcttgtttcaatgaggccgatgtcgtcgccatcgctgaggtttacgccgcaggcgaacag
ccgatcgaaggcgcgagccgtgatgacctcgtcgctggtttgatccgtcacggtcaccgt
catgcgcgcgccctgatctctgaagaagatctggaacgtctggttcgtgaacaggcgcgt
cccggtgatatggttgtctgcctcggggcagggacgatcagcacttgggcgaataacctg
cccgagcggatgaaggcgtga

DBGET integrated database retrieval system