KEGG   Roseiflexus castenholzii: Rcas_0386Help
Entry
Rcas_0386         CDS       T00585                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
rca  Roseiflexus castenholzii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase DZR zinc_ribbon_2 Pkinase_Tyr zf-ribbon_3 zf-RanBP zinc_ribbon_15
Motif
Other DBs
NCBI-ProteinID: ABU56518
UniProt: A7NGD1
LinkDB All DBs
Position
complement(484334..486691)
Genome map
AA seq 785 aa AA seqDB search
MPIANAPAVHQTRFHVLTPGTILQDRYLIERLLDRSPAGDFYLARDQRTKQPVDVKAITR
TEPDVDTLFAREVAALASLRHPALPAVVDMFAAPLGRFIVFDHIPGLSLEDIRARSPHAQ
LDADSAIRLLQPVLDALDQMHRHPARLAHRNVRPANIRITDAGQVYLTNPDVAGRSGAPF
DGRDLHADLCGIGATLYTLLTGAAPPLPAERVQHDTLRPVRQVRPDLSPELAQVIQRLLS
FDPAQQYASAAEAHRALTEAAPDVICPRCSKPNRASARFCRSCGAPLPASDPRSAIRAFI
GKLPSLPVATSPPDTATATFDFHTPTTSAATTVAAVSGVASKSATPALPSADAPTVDSPP
ADAPTVTSPPADATTFISPPADAPTVTSPPTDAATSISPPGKPASVEATAEAPAVSIPAP
PPAGAPPAAPVGGAQRQRSMLIGGIIAAIVLLLACVGGGYFALGAVGLLPGSATAVSGVS
PAPQATRTPATGGSAATAEARQNATATAIAIAQRATGTARAEGQTTTAQAGQSSEQQTAT
AMARQTVAVAAQQTAAAIAAATQTAAVPTATPAPQSLIPQPGALSLADYQAQTRGLRQLL
FETFDRGERTKAIWTQVDNERRRAALRDNLYYLTVKTPDLTTWYTWSRDLGNTYNIELSV
AFQTVGAPASVGIAFDVQPDANSGLFFEVTSDKRWLFSTVVDGQFITEGSTGLIPDEIIV
DGVGTNVLWVVRTPSEIQLWINSKHVATLPPSPFPGGQAGVCASSFSGLTEPATVIVDNF
RARAP
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgccgatagcaaatgcgcctgctgtgcatcagacgaggtttcatgtgctgacacctgga
acaatcctgcaagatcgctatctgatcgaacggctcctggaccgcagccccgccggtgat
ttctatctggcgcgcgaccagcgcacaaagcaacctgttgatgtcaaagccatcacccgt
actgagccggatgtcgataccctgtttgcgcgcgaagttgcggcgctggcctccttgcga
cacccggcgctccctgccgtcgtcgatatgtttgctgcgccactcgggcgctttatcgtc
ttcgatcatattccaggtctgagtctggaagacattcgcgcgcgatccccccacgctcaa
cttgacgcggattcggcgattcggctcttgcaaccagtgctcgatgcactcgatcagatg
caccgtcatccggcgcgcctcgcgcatcgcaatgtgcgtccggcaaacattcggattacg
gatgccggccaggtctatctcaccaatcccgacgtcgccggacgatccggcgctcctttc
gatggacgtgatctgcacgccgatctgtgcggcatcggcgcaacgctctacacgctcctc
accggcgccgcgccgcctctccctgcggaaagagtgcaacacgacacgctgcgtccggtg
cgccaggtccgtcccgatctctcacccgaactggcgcaggtcatccaacggttgttgtcc
ttcgacccggcgcagcagtacgcttccgctgccgaggcgcaccgggcgctcaccgaggcg
gcccccgatgtgatctgcccgcgctgctcgaaacccaatcgcgccagcgcgcggttctgc
cgctcgtgtggcgcgccgctgccagcgtccgatccgcgcagcgcaattcgcgcgtttata
gggaaacttccatccctgccggttgcaacgtctccccccgatacagccaccgcgacgttc
gacttccacacccccactacctctgccgccactactgtcgccgccgtctccggcgtcgcg
tcaaaatctgccacgcccgccctcccatctgccgatgctccgaccgtcgactccccgccc
gccgatgccccgaccgtcacctcgccccccgctgatgccacaactttcatctcgccgcct
gccgacgcaccaaccgtcacgtcgccccctaccgacgcggcgacctcgatctcacctccc
ggcaagccagcatcggtagaggcaaccgcagaagcgcccgcagtctcaattcctgcacca
ccccccgccggcgcacctccggcagcgccggttggtggtgcgcaacgtcagcgcagcatg
ctgatcggcgggatcatcgctgcaatcgttctcctgctggcgtgtgtgggtggcgggtat
tttgcgctgggagcagtagggttgctgccaggcagcgccactgccgtctccggcgtctcg
ccggcgccgcaggcaacgcggacaccagcaaccggtgggagcgctgcaactgccgaggcg
cggcagaatgcgaccgcgaccgccatcgccatagcgcaacgagcaaccggcacggcgcgc
gccgaagggcagacgacgacagcacaggcgggacaatcgtcagagcaacagacagcgacc
gccatggcccgccagacggtcgccgtagcagcgcagcagacggcagccgctatcgctgcc
gccacccaaactgccgccgtgccgactgcaacgcctgcgccgcagtcgctcattccgcag
cctggtgcgctctcgctggcggattaccaggcgcagacacgcggactacgccaacttctg
ttcgaaacctttgatcgaggcgagcgcacgaaagcaatctggacccaggtggacaatgag
cggcgtcgggcggcgctgcgcgacaatctctactacctgacggtcaaaacgccagacctc
acaacatggtacacgtggagtcgcgatctgggaaatacgtacaacattgagttaagtgtc
gcgtttcagaccgtcggtgcgccggcatcggtcggcattgccttcgatgtgcaacccgac
gcgaacagtgggctgttcttcgaggtgacgagcgataaacgctggttgttcagcaccgtg
gtcgatggacagttcatcacagaaggcagtaccggtctcattccagacgaaatcatcgtc
gatggcgttggcacaaacgtcctctgggttgtgcgcacccccagcgaaatccaactttgg
atcaacagcaagcacgtggcgacacttccgccgagtccctttcctggcgggcaggcaggc
gtgtgcgcctcatcgttcagcgggctgaccgagccggccacggtgatcgtggacaatttt
cgcgccagggcgccatag

DBGET integrated database retrieval system