KEGG   Roseiflexus castenholzii: Rcas_0807Help
Entry
Rcas_0807         CDS       T00585                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
rca  Roseiflexus castenholzii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 Pyr_redox_3 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ABU56924
UniProt: A7NHH7
LinkDB All DBs
Position
1058852..1059892
Genome map
AA seq 346 aa AA seqDB search
MQSKTMAALVWLGPRKMELRHEPVPTPGPGEVLVAVAAVGICGSELSGYLGQNSLRRPPL
IMGHEAAGRIAFDYDTPLSDGSPARAGARVTFNPLLTCGVCDLCRAGRSNLCRNRQLISA
HRPGAFAEYVSVPARLCVPLPDHVSLTLGSLTEPLACSVRAVAHAGAPRRLVILGAGPIG
LLCLVAARAAGIESILVSDVSDRRLAVARAWGATATVNARGHVLAAVQEFAPGGADAAID
AVGLTVTREQAVRAVIPGGRVVFIGLHEEESMVAANYIVRQEITVTGSFTYSDADFTRAL
DLLATGWVTLDDDWLEERPLAAGPAAFEELLAGTTRAAKIVLQMRE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccaaaacaatggccgcgctggtttggttgggaccgcgcaagatggagttgcgg
catgaacctgtgccgacgccgggaccgggcgaggtgctggtcgcagttgcagcggtcgga
atctgtgggtcggaactgagtggttatctggggcagaacagtctgcgccgaccgccgctg
attatggggcacgaggcggcaggacggatcgccttcgactacgacacgccgctgagcgat
ggctcgccggcgcgggcaggcgcacgggtcacgttcaatccattgctgacgtgcggtgtg
tgcgatctctgccgggcagggcgaagcaatctgtgccgcaaccggcagttgatcagcgct
caccgtccgggtgcatttgctgagtatgtgtctgttcctgctcgtctgtgcgtccctctg
ccggatcatgtgtcgctgaccctgggttcgctcaccgaaccgctggcgtgtagcgtgcgc
gccgtggcacatgccggagcgccgcgacgcctcgtcatactcggcgccgggccaattggg
ttgctctgcctggttgcggcgcgcgctgccggcatcgagtccatcctggtgagcgatgtg
tccgaccgccgcctggcggttgcgcgcgcctggggcgcaaccgcaaccgttaatgcccgt
ggtcatgttctggcggcggtgcaggaatttgcgccgggcggcgctgatgctgccattgac
gctgtggggttgacggtgacgcgcgagcaggcggtgcgcgccgtcattcccggtgggcgc
gtcgtcttcatcggattgcacgaagaagagtcgatggttgctgccaattatatcgtgcgc
caggaaatcaccgtgaccggcagtttcacctacagcgacgccgacttcacgcgggcgctc
gacctgctggcgaccggttgggtgacgctcgacgatgactggctcgaagagcgaccatta
gcggcgggaccggcggcattcgaggagttgctggcgggaacgacgcgcgcggcgaagatt
gtcctgcagatgagagaataa

DBGET integrated database retrieval system