KEGG   Roseiflexus castenholzii: Rcas_1222Help
Entry
Rcas_1222         CDS       T00585                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:rca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rcas_1222
Enzymes [BR:rca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Rcas_1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII LuxC
Motif
Other DBs
NCBI-ProteinID: ABU57319
UniProt: A7NIL9
LinkDB All DBs
Position
complement(1579902..1581395)
Genome map
AA seq 497 aa AA seqDB search
MSTPPVYQNLIGGKFVDSASGRTFENRNPADTREIIGIFQDSDERDVQAAVEAAKRAYRY
WRLVPAPKRGEILFKAAQLLVERKEQYARDMTREMGKVLKETRGDVQEAIDMCFFMAGEG
RRLYGQTTPSEMPNKFQMSVRQPVGVCGLITPWNFPMAIPSWKILPALIVGNTVVIKPAS
DTPLSVYNLVQCLLDAGIPDGVINIVTGSGSRVGEPLIRHPDVQVISFTGSTEIGSKVAR
VGAEGMKHVSLEMGGKNPMIVMDDANLDLVVDGAIWGAFGTTGQRCTATSRLIAHRAIVG
ELTERLADRAERLKIGNGLDETVEMGPSINQSQLETVQRYVEIGASEGARLVVGGRTLRD
GDYAYGFFHQPTIFADVQRHMRIAQEEIFGPVLSIITVDSLEEAIDVANDVPYGLSSAIY
TRDVNAAFRAMRDLYTGIVYVNAPTIGAEIHLPFGGTKGTGNGHREGGIQVLDVFSEWKS
IYVDFSGTLQRAQIDNY
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactcctccagtataccagaacctgatcggcggcaagtttgtcgactccgcaagc
ggacgaacgttcgagaaccgcaacccggcggacacgcgcgagattatcggcattttccag
gacagtgatgagcgcgacgtacaggcggcggtcgaggcggcgaagcgggcataccgttac
tggcggctggttcccgcgccgaagcgtggcgaaatcctgttcaaagccgcgcagctgctc
gttgagcgcaaagagcagtacgcccgtgacatgactcgcgagatgggcaaggtgctcaag
gaaacacgcggtgatgtgcaggaagccatcgacatgtgcttctttatggcgggtgaaggg
cggcgcctctatggccagacaaccccctccgaaatgccaaacaagttccagatgtcggta
cgccagccggtcggcgtctgcgggctgatcacgccatggaacttcccgatggcgattccg
tcctggaagatcctgccagcactgatcgttggcaacacggtggtcatcaaacccgcctcc
gacacgccgctgtcggtgtacaacctggtccaatgcctgctcgacgccggcattcccgac
ggcgtgatcaacatcgtcaccggcagcggaagtcgcgttggcgagccgctgattcgccat
cccgatgtacaagtcatttcctttaccggttcgaccgagatcggcagcaaagtcgcgcgc
gtcggggccgaggggatgaaacacgtctcgctggagatgggcggcaaaaacccgatgatt
gtgatggacgacgccaacctcgacctggtcgtcgatggcgcgatctggggcgccttcggc
acgaccggtcagcgctgcaccgccacctcgcggctgatcgcccaccgcgccattgtgggc
gaactgaccgagcgcctggcggatcgcgctgagcgactgaagatcggcaacgggcttgat
gaaaccgtcgagatgggaccatcgatcaaccagagccagctcgaaacggtgcagcgctac
gtcgaaattggtgcgagcgaaggggcgcggctggttgtcggcgggcggacgctgcgagat
ggcgattacgcctatgggttcttccatcagccgacgatctttgccgatgtgcagcgtcac
atgcgtattgcccaggaagagattttcggtccggtgctgtcgatcatcacagtcgatagc
ctggaagaggcgattgatgtcgccaacgacgtgccgtatggattgtcgtctgcgatctac
acccgcgacgtgaatgccgcatttcgcgctatgcgcgacctgtacaccggcatcgtgtac
gtgaatgcgccaacgattggcgcggaaatccatctccccttcggcggcaccaaaggcacc
ggcaatgggcaccgcgaaggcggcattcaggtgctcgacgtcttcagcgagtggaaatcg
atctacgtcgatttttcgggcacgctccagcgtgcgcagattgataattattga

DBGET integrated database retrieval system