KEGG   Roseiflexus castenholzii: Rcas_1241Help
Entry
Rcas_1241         CDS       T00585                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00020  Citrate cycle (TCA cycle)
rca00480  Glutathione metabolism
rca00720  Carbon fixation pathways in prokaryotes
rca01100  Metabolic pathways
rca01110  Biosynthesis of secondary metabolites
rca01120  Microbial metabolism in diverse environments
rca01130  Biosynthesis of antibiotics
rca01200  Carbon metabolism
rca01210  2-Oxocarboxylic acid metabolism
rca01230  Biosynthesis of amino acids
Module
rca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rca_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rcas_1241
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Rcas_1241
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rcas_1241
Enzymes [BR:rca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Rcas_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABU57338
UniProt: A7NIN8
LinkDB All DBs
Position
1603981..1605345
Genome map
AA seq 454 aa AA seqDB search
MTATRNRAPEGDPISIQNGRLHVPDMPIIPYVEGDGTGPDIWRASVRVFDAAVERAYGGR
RKLMWYEVLAGEKAFNLTGSWLPDETVEAFKHYLVGIKGPLTTPVGKGIRSLNVALRQLL
DLYVCLRPVRYFQGVPSPVKRPELVDMVIFRENTEDIYAGIEYAAGTPEAQCVLDFLRTT
FPKDFEKIRFGTGDKVREFLAMLGDGGDEGAVEVGIGIKPVSRLGTERLVAAAIQYAITH
RRRSVTFVHKGNIMKFTEGAFRDWGYALAERAFGEHVYTWAQWERTKAEKGEAAANAEQR
EALAAGAILIKDAIADITLQQVLTRPEEFDVIATLNLNGDYLSDALAAQVGGIGIAPGGN
INYITGHAIFEATHGTAPKYANLDRVNPGSVILSGDMMLRYLGWTEAADLIIRALEKTIA
QKIVTYDFARLMTGAKEVKTSQFADAMIANMDGE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgacgcgcaaccgtgcgcccgagggagatccgatttcgatccagaacgggcgc
cttcatgtgccagatatgcccattattccttatgtcgaaggcgatggcaccggtcccgat
atctggcgggcaagtgtgcgcgtcttcgatgccgccgtcgaacgggcgtatggcggtcgg
cgcaaattgatgtggtacgaagtgctggcgggtgagaaagcattcaacctgacaggcagc
tggttgccggacgaaacggtggaagcgttcaagcactacctggtcggcattaagggtccg
ttgacaacgccggtgggcaaaggaattcggagcctgaacgtcgcgctgcgtcagttgctc
gatctctatgtctgtttgcgcccggtgcgctattttcaaggggttccgtcgccggtgaag
cgccccgaattagtcgatatggtcatcttccgtgagaatacggaagacatctatgccggc
atcgagtatgccgccggcactcccgaagcgcagtgcgtgctcgacttccttcgcacgacc
tttccgaaagacttcgagaaaattcgctttggtacgggtgataaagtgcgcgagtttctc
gccatgctaggggatggcggggatgaaggcgcggttgaagttggcatcggcatcaaaccg
gtcagtcggttgggaacagagcgcctggtggctgccgccattcagtatgccatcacccat
cggcgcagaagtgtcacttttgtgcataaaggcaacattatgaagttcactgaaggagcg
ttccgcgattggggatacgcgctggcagaacgcgcctttggtgaacacgtctatacctgg
gcgcaatgggagcgcaccaaagccgaaaagggcgaggcggcggcgaacgccgagcagcgc
gaggcgctggctgccggtgcgattctcatcaaggacgcgattgccgacatcacgctccag
caagtgctgacgcgaccggaggagttcgatgtgattgcgacccttaatctcaacggcgac
tacctgagcgatgcgctggcggcgcaggtaggcggcatcgggatcgcgccgggggggaat
atcaactacatcaccggtcacgcaatctttgaagcgacccacggtacggcgccgaagtac
gccaatctggatcgcgtcaatccgggcagcgttatcctgagcggcgatatgatgctccgc
tatctggggtggaccgaagcggcagacctgatcattcgcgcgctcgagaagacgattgcg
cagaaaatcgttacctacgactttgcgcgcctgatgaccggcgcgaaagaagtcaagacg
tcgcaattcgctgatgctatgatcgccaatatggatggcgagtag

DBGET integrated database retrieval system