KEGG   Roseiflexus castenholzii: Rcas_1255Help
Entry
Rcas_1255         CDS       T00585                                 

Definition
(GenBank) domain of unknown function DUF1727
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00550  Peptidoglycan biosynthesis
rca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rcas_1255
Enzymes [BR:rca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     Rcas_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M DZR Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: ABU57352
UniProt: A7NIP9
LinkDB All DBs
Position
complement(1623081..1624604)
Genome map
AA seq 507 aa AA seqDB search
MIDIRLLLAVAAGKSTGVASRVLRRGGGTTLPGVVARRVDPQALRKLAVALPQGVVLVSG
TNGKTTTTRMIAAMLADDGRAPLHNRAGANLISGVTATALAGVSFGGRSPARIGLFETDE
AAFPGIAAETTPRLVVLHNLFRDQLDRYGEVDTVAKGWRSALERLPATTTVLLNADDPAV
AALGEGLSAKVRFYGLNDRRYASGAAAQIGDARFCRRCGAPYRYTALFYAHVGHYRCDRC
SAARPTPDYALERLDLHGVKESMLCLTFPGGAMELHLPLPGLYNAINALAAIAACLELGV
PAPRIRATLEHFDAAFGRIERVDAGGRPLLIALIKNPVGATETIRMLTDALNVERSTHVA
TLQSNAAQAAETLQGDAASAERSRCNVSTNNLHPSTLLHLLILINDRHADGTDVSWLWDA
EFERLAGHVARATIGGTRAADMAVRLKYAGVESECISVVDDPADALDAALERLPASATLY
ALPTYTAMLDLRAELVRRRWARPFWED
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgattgatatccgactgttgctggcggtcgctgccggtaaatcgaccggcgtcgccagc
cgcgttctgcggcgcggcggcggtacgacgctccccggcgtcgttgcccggcgcgtcgat
ccgcaagcgctgcggaaactggcggtggcgctgccgcagggagttgtgctcgtttccggc
accaacggcaaaacgactaccactcggatgattgcggcgatgctggcggacgatggacgc
gcgccactccataatcgcgccggcgcgaacctgatcagcggcgtaacggcaacggcgcta
gcgggtgtgtcgtttggcggacgctccccggcgcgaatcggtctgttcgaaactgatgaa
gccgcctttccgggcatcgcagcagaaaccacacctcgcctggttgtgctccataatctg
ttccgcgatcaactcgaccgctacggcgaagtggataccgtagcgaaggggtggcggtca
gcgctcgaacgccttcccgccacgacaaccgtcttgctcaatgctgatgatccggcggtc
gcggcgcttggagagggactatccgccaaagtgcgcttctatggactcaatgatcgacgc
tacgcatcgggggcggcggcgcagatcggcgatgcccggttttgccgtcgctgcggtgcg
ccataccgctacacggcgctcttctacgcgcacgtcgggcattaccgctgcgataggtgc
agcgcggcgcgcccaacacccgactatgctctggaacggttggacctccatggtgtgaaa
gagtccatgctctgcctgacgtttccgggaggtgcgatggaactccatctgcctcttcca
ggtttgtacaacgcgatcaacgcgctggcagcgattgcggcatgtctggaacttggcgtt
ccggcgccacgtattcgcgcgacgctcgaacatttcgacgctgcttttgggcgtatcgaa
cgggttgatgcgggcggacgcccgttgctgatcgccctgatcaaaaaccctgttggcgcc
accgaaaccattcgcatgctgacggatgcgttgaatgttgaacgttcaacgcatgtcgca
acgttgcagagcaacgcagcgcaagcggcggagacgttgcagggcgacgcagcatcagca
gaaaggtcgcggtgcaatgtctctaccaataaccttcatccttcaaccctgcttcacctt
cttatcctgatcaatgatcgccatgctgatggaacggatgtttcgtggctatgggacgcg
gaattcgagcgcctggcgggacatgtggcgcgcgcgaccatcggcggaacgcgcgcggca
gatatggcggtgcggctgaaatatgccggggttgagtcggaatgtatcagcgtcgtggat
gacccggcagacgcgctggacgcggcgctcgaacgattgcctgccagcgcaacgctctat
gcgctgccaacgtatactgctatgctcgacctgcgcgctgagttggtgcgccgccggtgg
gcgcgaccgttctgggaggattag

DBGET integrated database retrieval system