KEGG   Roseiflexus castenholzii: Rcas_1371Help
Entry
Rcas_1371         CDS       T00585                                 

Definition
(GenBank) protein-disulfide isomerase-like protein
Organism
rca  Roseiflexus castenholzii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_4 DSBA Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: ABU57467
UniProt: A7NF84
LinkDB All DBs
Position
1753486..1754313
Genome map
AA seq 275 aa AA seqDB search
MYQNTDKAGMTPHRQRAAAALLFLFMVIAALMTDHAQAQNDADPRGLGDPNAPIVIIEYS
DYECPACASFVRDAKPQLIAEYIETGKVYYLYRDNPLPQHPAGRIAAIYAHCAVRQGQFW
PMHRRLFQGYIDGEWGGDPSASERVFRRYGDELGLDSGALQECVRDPTTEQAIAADIEEA
RNRGLRGTPAYILRWPGGPERGDVLTGAQSFGTWRALLDERLSAQPDPATASPGFGAQAS
LFIYLALGAAGGLAVLVVGGSILWWLARRDHSSPM
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagaacaccgacaaggcaggtatgacgccacatcgccagcgcgctgctgctgca
ttgctattcctgttcatggtcatagccgcactgatgacggatcatgcgcaggctcagaat
gacgccgacccacgcgggttgggcgaccccaacgcacccattgtcatcatcgagtacagc
gactacgagtgcccggcgtgtgcgtcattcgtgcgtgatgccaagccgcaattgattgct
gaatacatcgagacgggcaaggtctactacctctaccgcgataatccgctgccgcagcat
ccggcgggacggattgcggcgatctatgcgcattgtgccgtgcggcaagggcaattctgg
cccatgcaccgacgtttgttccaggggtacatcgatggcgagtggggtggtgacccatct
gcgtcggagcgtgtgttcaggcggtatggcgatgaacttgggctggactccggcgcgctc
caggaatgcgtgcgtgatccgacgacggagcaggcaattgccgctgacatcgaagaagcg
cgcaatcgcgggttgcgtggaacgcctgcctatattctgcgctggcccggcggtccagag
cgcggcgatgtgttgaccggcgcgcagagtttcggcacctggcgcgccctgctcgatgaa
cgtctgagcgcacagcccgatccggcgactgcctcgccgggatttggggcacaggcgtcg
ctgttcatctacctggcgctcggcgcagcaggcggtctcgctgtgctggtcgttggcgga
agcatcctctggtggcttgcccggcgcgaccactcttcgccaatgtag

DBGET integrated database retrieval system