KEGG   Roseiflexus castenholzii: Rcas_2377Help
Entry
Rcas_2377         CDS       T00585                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00620  Pyruvate metabolism
rca00680  Methane metabolism
rca00720  Carbon fixation pathways in prokaryotes
rca01100  Metabolic pathways
rca01120  Microbial metabolism in diverse environments
rca01200  Carbon metabolism
Module
rca_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rcas_2377
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Rcas_2377
   00680 Methane metabolism
    Rcas_2377
Enzymes [BR:rca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Rcas_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ABU58459
UniProt: A7NLR3
LinkDB All DBs
Position
3063554..3066370
Genome map
AA seq 938 aa AA seqDB search
MSHTPHNRRHESERLSATIRFLGNLLGDVIREQAGEAAFQLVERLRTLGKELRNGAPDRA
DAELRMMAARMTVADIQIVIKAFNAYFLLVNLAEQMQRVWVLRDRERKYPDTPRPESIAA
AIAELHACGIPATTIQEWLDTACIQPVFTAHPTEARRRTALEKVRRLATLLDERTGDLHG
FVREENTMRIREEIVSLWQTDEVRVVKPTVIDEVKNGMFYFESGLFDLIPRLYRELEYAL
RTTYPTHEWRVPPLLRYGAWMGGDRDGNPNVTHTVTIQAVRMMRAAAIERHIAAVEELSH
RLGQSVRQAPVSDELRESLAHDASLFPEVADMLARRNPYELYRQKCTYIREKLIRTLDYA
RTASLDWGRSDSPPKGAYFSRTDLLDDLHVMERSLLSNNAAIVANGALRDLIRQAEVFGL
HTATLDIRQHSERHTAALAEVLAAAGVCADYTALNEIERIELLSREIENPRPLIPTRLDY
SPDTVEVIATFRAVASILERLSPEAVETCIVSMTRGASDLLAPLLLAKEAGLFRPFRFSR
LSMAPLFETGADLACCDEVLEACMRLPIYRNHLALRGFVQEVMIGYSDSNKDVGYAAANW
AIYQAQRKLRDFGRRHGIQMRLFHGRGGAIGRGGGPANHAILAQPPGSIGNQIKITEQGE
VIADRYGLPLLAHRHIEQVINAVLRAGLLQRDDPPDEWTQALERLAALSQRHYRALVYER
SDFVPYFRNVTPIAEISRLNIGSRPASRRNTERIEDLRAIPWVFSWMQSRHTLPGWYGLG
FALETFVYAGEQSDASGSAIDRLALLQEMYARWSFFRVMIDNAQMILGKADLHIASRYAE
LAPDQNAAAAIFAAIREEYQRASRMIRQVARIERLLDNAPVLQHSIQRRNPYIDPMSYLQ
IELLRRLRAAPDGPDHAAIEDAILLSISGLAAGLMNTG
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatacgccacacaaccggcgccacgaaagcgagcgcctctcagcaacgatccgg
tttcttggcaacctgttgggcgacgtcattcgtgaacaggcgggtgaagcagcattccaa
ctggtagagcgcctgcggaccctgggaaaggagttgcggaacggcgctccggatcgcgcc
gatgccgaactgcggatgatggccgctcgaatgaccgtcgccgacatccagatcgtcatc
aaggcattcaacgcctactttttgctcgtgaaccttgccgaacagatgcagcgcgtctgg
gttttgcgcgatcgtgagcgaaaataccccgacacaccgcgtcccgagtcgatcgcggcc
gcgattgccgaactgcatgcctgcggcatccctgcgacgacgattcaggagtggctggat
accgcctgtatccagccggtcttcactgcgcacccaaccgaagcgcgccgtcgcacggcg
ctcgagaaagtgcgtcggcttgcgacgttgctcgacgagcgaaccggcgatctgcatggt
ttcgtgcgtgaagaaaacacaatgcgcattcgcgaggagatcgtttccttatggcaaact
gatgaggtgcgggttgtcaaaccaacggtgatcgacgaggtcaagaacggtatgttctac
ttcgagagcggattgttcgacctgatcccgcgcctctaccgtgaactggaatacgccctc
cgtaccacgtatccaacccacgagtggcgcgtgccgccgctgctgcgctatggcgcatgg
atgggaggcgaccgcgatggcaatccgaatgtcacgcatacggtcacgattcaggcagtt
cgcatgatgcgcgccgccgctattgaacggcatattgccgctgtcgaagaactcagccat
cgcctcggtcagtccgtgcgacaggcgccggtcagcgacgagttgcgcgagtcgctcgcg
catgatgcgtcgctctttcctgaagtcgccgatatgctggcgcgacgcaacccgtatgaa
ctctaccgccagaagtgcacctatatccgcgagaaactgatccgcaccctcgactatgcc
cgtaccgcatcgctcgactggggacgatccgactcaccgccgaagggcgcctatttcagc
cgcactgatctgctcgatgatctgcacgtgatggagcgcagtttgttgagcaataatgcc
gccatcgtcgccaatggcgcgctgcgcgatctgatacgccaggcggaggtctttggactt
cacacggcgacgctcgatattcgccaacacagtgagcgtcacaccgccgcgctcgccgaa
gtgttggcggcggccggcgtctgcgccgactatactgcgctcaatgaaatcgaacggatc
gaattgttgtcgcgcgaaatcgaaaacccgcgtccactcatcccaacccgtctcgactac
tcccctgataccgtcgaggtgatcgccacattccgcgccgtcgcttcaattctcgaacgt
ctcagtcccgaagccgtcgagacctgcattgtcagtatgacgcgcggtgcaagcgacctg
ctggcgccgcttcttctggcaaaggaggcggggttattccgtccgttccgtttcagtcgg
ctgagcatggcgccgctcttcgagaccggcgccgacctcgcatgttgcgacgaggtgctc
gaggcgtgtatgcggttgccgatctaccgcaatcacctggcgctgcgcggtttcgtccag
gaagtgatgatcggttattccgacagcaacaaagatgtcggttatgctgcggccaactgg
gcgatctaccaggcgcagcgcaaactgcgtgactttggacgacgccatggcattcagatg
cgcctgtttcatgggcgtggcggcgccatcgggcgcggcggcggaccggcgaaccatgcc
attctggcgcagcctcccggcagcatcggcaaccagatcaaaatcaccgagcagggcgaa
gtgatcgccgatcggtatggattgccgctgctggcgcaccggcatatcgagcaggttatc
aatgccgtattgcgcgccggtctgctccagcgcgatgatcctcccgacgagtggacgcag
gcgctcgaacgattggctgcgctttcgcaacgccactaccgcgcgctggtctatgagcgc
tccgattttgtgccctactttcgcaatgtgacgccaattgctgaaatcagtcggctgaat
atcggtagtcgtcctgcgagccgccggaataccgaacggatcgaagacttgcgcgccatt
ccgtgggtgttcagctggatgcaaagccggcatactctgccggggtggtatggtctgggg
tttgccctcgaaacatttgtatacgcaggagaacagagtgacgcatcggggtccgccatc
gaccgcctggcgcttctccaggagatgtacgcccgttggtcctttttccgcgtcatgatc
gacaatgcccagatgattctgggcaaagccgatcttcacatcgcatcgcgctatgcggaa
cttgcgcccgatcagaatgccgcagccgccatctttgccgccatccgcgaggagtaccaa
cgcgccagccggatgatccgccaggttgcgcggatcgaacgcctgctcgataatgcccct
gtgctgcaacattcaatccagcgccgcaatccgtatatcgatccgatgagttaccttcag
atcgaactcttgcgtcgcctgcgcgccgcgcccgacggaccggatcacgctgccatcgaa
gatgctatcctgctgagcatcagcggtctggcggcaggactgatgaataccggttag

DBGET integrated database retrieval system