KEGG   Roseiflexus castenholzii: Rcas_2590Help
Entry
Rcas_2590         CDS       T00585                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
rca  Roseiflexus castenholzii
Pathway
rca00500  Starch and sucrose metabolism
rca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rcas_2590
Enzymes [BR:rca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Rcas_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: ABU58666
UniProt: A7NMA4
LinkDB All DBs
Position
complement(3342527..3344935)
Genome map
AA seq 802 aa AA seqDB search
MTQTTVRYAPGWPGIPARWTSSAKTGIGTALNPASRVWFTISHGILNEIYYPRIDQACTR
DCGLIVTDGHSFFSEEKRHTTSIVTMLAVGVPAYRLVNRCQQHRYQIEKMVITHPMYNAV
LQQITFTPLQGSLDQYSVFVLLAPHIGNRGAENTAWIGDYKGLPMLFAERYGLALAVACS
APWTARSVGFVGSSDGWQDLVRNYRLTTLYERAENGNVALTGGIDVMACHGQFTIAIGFG
QTWAEAAWHARAGLSDEFDSVCATYIQAWQTWQQTLTALTTIHQQVSAMVLRVHESKQFP
GGSIASLSIPWGMAKGDDDLGGYHLVWPRDLVEIGGGLLAIGANDDAWRILNYLALTQEP
DGHWPQNMWLDGIPYWNGIQMDETAFPILLLDLAVTTGAIDPATVYRYWPMVRRAASFLV
RNGPVTAQDRWEENAGYSPFTLAVEIAALLVTAELAEQYGEPTIADYLRTTADSWNADID
RWCYVTGTDLAHRVGVTGYYVRIAPPDVAEAASPMQGYVPIKNRPPDQANAPLSYIVSPD
ALALVRFGLRDPHDPRIVNTVQVIDALLKIDTPCGPVWRRYTDDGYGEHQDGAPFDGTGI
GRGWPLLTGERAHYELAAERVEAAKRLLITLEAFANEGGFLPEQVWDSTDIPERELFFGR
PAGSAMPLAWAHAEHLKLCRSLADQRLFDMPRVTAQRYLSRQVQSKIAIWRPNQKRRRIV
AGMTLRIDLNAAAMIHWSADHWQTIHDTTTAASGLGTFFADLPTETLAPATEIVFTLYWI
DQQRWEGRDYTVQIEASGISGE
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaacaacggtacgctatgcacccggttggcccggtattccggcacgctggact
tcgagcgccaaaaccgggatcggaactgcgttaaacccggccagccgggtctggtttacg
attagccacggtattctcaacgagatctactatccgcggattgatcaagcttgcacccgc
gattgtggcttgattgtcaccgatggtcattcgtttttctctgaagagaaacgtcatacc
accagcatcgttacgatgctggccgtaggtgtgccggcttaccgattggtgaacagatgc
caacaacatcgctatcagatcgagaaaatggttatcacccatccaatgtacaacgcggtg
ttgcagcagattacctttactccactgcaaggttcgcttgatcagtattcggtgtttgta
ttactggctccgcatatcggtaatcgtggtgctgagaatacggcatggatcggtgactac
aaaggattgccgatgctctttgccgagcggtatggtcttgccttggctgtagcttgctcg
gccccgtggacagcacgctcggtcgggtttgtcggcagctctgatggctggcaagatttg
gtccgtaactatcgactgacaactctttacgaacgggcagaaaacggcaatgtggccctg
accggcgggatcgatgtgatggcatgtcacgggcagtttactatcgcgattggcttcggt
caaacatgggctgaagcggcgtggcatgcccgtgccggtctgagcgacgaattcgactcc
gtctgcgctacgtacatccaggcttggcaaacgtggcaacaaacgctcactgctctgacc
accattcatcaacaggtgagcgcgatggtgttacgggtacatgaatcgaagcaatttccc
ggtggaagtatcgccagcctctctattccatggggtatggccaaaggtgatgatgacctc
ggtggttatcatctggtgtggccgcgcgatctggtcgaaattggtggtggactactggca
atcggagccaatgatgatgcatggcgtattctcaattatcttgcccttacccaagaaccc
gatggacactggccgcaaaatatgtggctcgacggtataccgtactggaacggtattcaa
atggacgaaacggcatttcctatcttactcctcgacctggcagtaacgactggcgcgatt
gatccggctaccgtttaccgctattggccaatggttcgacgcgcggcgagtttccttgtt
cgcaatggaccggtcaccgcccaagatcgctgggaggagaacgccggctactcacccttt
acactagcagtggaaattgctgccctgctcgtgaccgccgaactggccgaacagtatggt
gaaccgactatcgctgactatctccgcaccacagccgatagctggaatgccgatattgac
cgctggtgctacgtgaccggaaccgatcttgcccatcgtgtcggagtaacggggtattat
gtacggattgcaccacccgatgtcgccgaagcggcttcaccaatgcaaggctacgtgccg
attaagaatcgtccacccgaccaagccaacgcaccgctgagctatatcgtcagtcctgat
gctttagcccttgtgcgtttcggcttgcgcgacccacacgatccacggattgtaaataca
gtacaggtcatcgacgcactattgaagatcgatacaccgtgtggaccggtgtggcgacgg
tacaccgacgatggttacggtgaacatcaagatggtgctccatttgacggcaccggtatc
ggtcgtggatggccgttactgaccggtgaacgcgctcactacgaacttgcagccgagcga
gttgaagcggcgaaacgactgctcataacgttggaagcgttcgcgaacgaaggtggtttc
cttcccgaacaggtgtgggacagtaccgacattcccgaacgagagcttttttttggccgg
ccagcggggtcagccatgccgctcgcgtgggctcatgccgaacaccttaaactttgccgt
tctcttgccgaccaacgtctgtttgacatgccacgagtgaccgcacagcggtatctcagt
cggcaggtgcagagcaagattgccatctggcgtccgaaccaaaaacgacggcgaatagtg
gcagggatgacgttacgtatcgatctgaatgccgctgcgatgatccactggagcgccgat
cactggcagacgattcacgataccacgacggctgctagcggactggggacctttttcgct
gatttaccgaccgaaacgttggcgcctgcgactgagatcgtgtttacgctgtactggatc
gatcaacaacggtgggaagggcgcgattacacagtgcagatcgaagcatccggcataagc
ggagagtag

DBGET integrated database retrieval system