KEGG   Roseiflexus castenholzii: Rcas_3040Help
Entry
Rcas_3040         CDS       T00585                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rca  Roseiflexus castenholzii
Brite
KEGG Orthology (KO) [BR:rca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rca01001]
    Rcas_3040
Enzymes [BR:rca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Rcas_3040
Protein kinases [BR:rca01001]
 Serine/threonine kinases: Other
  Bacterial family
   Rcas_3040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like Kdo RIO1
Motif
Other DBs
NCBI-ProteinID: ABU59094
UniProt: A7NNF8
LinkDB All DBs
Position
complement(3940165..3941940)
Genome map
AA seq 591 aa AA seqDB search
MQKKILNNRYELEQKIGEGGMARVYLGRDLRLNRRVAIKALHEHYAADVTFLQRFHHEAQ
AAAGLRHPCIVNVYDVGQDGDIHYIVMEYVEGSDLKSLILRNGPLPINHAVAIAEDVAEG
LEAAHRIGMVHRDVKPQNILVSPAGEVKITDFGIAKSSLSTALTETGVTFGTADYLSPEQ
ARGFAATPRSDIYALGVTLYEMLTGHLPFTGENAVAVAMQHVSVDPPPPRMFNPHIPPRL
EELVLVALSKNPDERPASGREFAQMLHAYRMASQDATIVRPAPRSSQPRPAPGPMAVAPA
GSVASRTMLPPPRSPVVTQAPPAGGGRDVGVFLLGMVFIGLILGVVYLAATGAFDNLFQF
SGGTRPPPIVLPEPTAEPTATPAPEMVIVPNVVGLDERAAITAIEGAGLLPFAELPRASD
VVSAGLVFDQFPPATTVVTASTVVTYVVSTGPEMIPLPEVVTMRGVDAEFQLRSLGFQVQ
VVSAPDRLSAGFVFRTEPAAGTPLRRGDTVTIFVSIGDKVRMPDVTGLAEEEAIRRIVAA
GLTWSYSDYQGCDKLGDLCDRYAPGVVVSSIPRGGEQVDRGSPVTLGVRAP
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaaaatcctgaacaatcgctacgaactcgagcagaagattggcgaaggcggc
atggcgcgcgtctatctcggtcgcgatctgcgtctcaatcggcgggtggcgatcaaggcg
ttgcacgagcactatgctgccgatgttacatttcttcagcgcttccatcacgaggcgcag
gctgccgctggtctgcgccatccgtgtatcgtcaatgtgtatgatgtcgggcaggacggt
gatattcactatattgtcatggagtatgttgagggcagcgatctgaagagtctgatcctg
cgcaacggtccactcccgatcaatcacgctgttgcgattgccgaagatgtcgccgaaggg
ctggaagcggcgcaccggataggcatggtccaccgcgatgtcaagccgcagaatattctg
gtcagccctgccggcgaagtgaaaatcaccgattttggcattgcgaaaagttcgctctcg
acggcgctgaccgaaaccggtgtgacgtttgggacggcggattacctctcaccagaacag
gcgcgtgggtttgccgccacgccacgttccgacatctatgccctcggtgtgacgctgtac
gaaatgctgaccggtcacctgccgttcacgggcgaaaatgcggtggctgtagcgatgcaa
catgtcagtgtcgatccgccgccgccgcgtatgttcaatccgcacattccgccgcgtctg
gaagagttggtgcttgttgcgctcagcaagaatcccgacgaacgccccgcatcggggcgc
gagtttgcgcagatgctgcacgcatatcggatggcaagccaggacgcgacgattgtgcgc
ccggcgccccgttcgtcacaaccgcgaccggcgccgggaccgatggcagtggcgccggcc
gggagcgtcgccagtcgaacgatgttgccgccgccgcgttcaccggttgtcacacaggcg
ccgcccgcgggcggcggtcgtgatgttggcgtctttctgctggggatggtgttcattggt
ctgatcctgggcgtggtctacctggctgccaccggcgcattcgataacctgttccaattc
agcggcggaactcgcccgccgccgatcgttctccctgaaccgactgctgagccaacggca
actcctgcgccggagatggtgatcgtgccgaatgtcgtcggtctggacgagcgcgcagcc
attacggccattgagggcgctggtctgctgccgttcgcggaactcccccgcgcctccgat
gttgtctcagccgggttggtgttcgatcagtttcccccagcgacgacggtggtgacggct
tcgacggtggtgacctatgtggtcagcaccggtcctgagatgatcccgttgcccgaagtt
gtgactatgcgcggcgtcgatgccgagtttcagttgcgcagtctgggatttcaggtgcaa
gtcgtcagtgcgccggatcgcctcagcgcagggtttgtctttcgcaccgaaccggcagcc
gggacgccgctgcgacgtggtgatacggtgaccatcttcgtcagcattggcgataaggtg
cgcatgccggacgtcaccgggcttgcggaggaggaggcgatccgccggattgtcgccgcc
gggctgacctggtcgtactccgactatcaggggtgcgataaactcggcgatctgtgcgac
cggtacgctcctggcgtggtcgtcagttccatcccgcgcggcggtgaacaggtcgatcgt
gggtcgccggtcacgctgggggtgcgtgctccgtaa

DBGET integrated database retrieval system